Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A409VUR2

Protein Details
Accession A0A409VUR2    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
14-41SSSDATSNRYRRKKRVIWRYRWRTAPKLHydrophilic
NLS Segment(s)
PositionSequence
24-32RRKKRVIWR
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MPRTPPGDDSASESSSDATSNRYRRKKRVIWRYRWRTAPKLLRRQESNNCPPSMQQIAVTRPEVLVAAANTSASRVGPALGHSGELRNLQQIVGTFGSPQTASFDLPSASELPPAYENRDTP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.19
3 0.19
4 0.13
5 0.14
6 0.21
7 0.29
8 0.39
9 0.48
10 0.55
11 0.64
12 0.74
13 0.79
14 0.82
15 0.84
16 0.85
17 0.86
18 0.9
19 0.9
20 0.87
21 0.87
22 0.83
23 0.77
24 0.76
25 0.76
26 0.74
27 0.75
28 0.74
29 0.72
30 0.7
31 0.71
32 0.7
33 0.69
34 0.68
35 0.64
36 0.57
37 0.51
38 0.46
39 0.43
40 0.36
41 0.27
42 0.21
43 0.19
44 0.2
45 0.22
46 0.22
47 0.18
48 0.15
49 0.15
50 0.12
51 0.09
52 0.07
53 0.05
54 0.05
55 0.05
56 0.05
57 0.05
58 0.05
59 0.05
60 0.04
61 0.05
62 0.04
63 0.05
64 0.05
65 0.06
66 0.09
67 0.08
68 0.09
69 0.1
70 0.1
71 0.12
72 0.13
73 0.12
74 0.12
75 0.12
76 0.11
77 0.12
78 0.11
79 0.14
80 0.13
81 0.13
82 0.11
83 0.11
84 0.12
85 0.11
86 0.11
87 0.11
88 0.11
89 0.12
90 0.13
91 0.14
92 0.13
93 0.13
94 0.14
95 0.13
96 0.12
97 0.14
98 0.14
99 0.15
100 0.19
101 0.21
102 0.25