Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A409W6B2

Protein Details
Accession A0A409W6B2    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
65-90RGTEYQPSQRKRKRKHGFLARKRSVGBasic
NLS Segment(s)
PositionSequence
74-104RKRKRKHGFLARKRSVGGRKVLARRMAKGRK
Subcellular Location(s) mito 23, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MPRIPLALLLRPPRLPVLNAVRILTRPQPTAPSFSPATLFRTPTALPAVQSPSPLYQLSVRFAQRGTEYQPSQRKRKRKHGFLARKRSVGGRKVLARRMAKGRKYLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.31
3 0.32
4 0.35
5 0.37
6 0.38
7 0.37
8 0.34
9 0.33
10 0.35
11 0.33
12 0.28
13 0.24
14 0.23
15 0.29
16 0.29
17 0.34
18 0.32
19 0.3
20 0.28
21 0.26
22 0.28
23 0.23
24 0.27
25 0.23
26 0.23
27 0.19
28 0.21
29 0.2
30 0.2
31 0.22
32 0.16
33 0.14
34 0.15
35 0.18
36 0.16
37 0.16
38 0.15
39 0.13
40 0.15
41 0.14
42 0.13
43 0.12
44 0.14
45 0.15
46 0.18
47 0.18
48 0.17
49 0.17
50 0.18
51 0.16
52 0.17
53 0.19
54 0.22
55 0.23
56 0.3
57 0.39
58 0.43
59 0.52
60 0.58
61 0.64
62 0.67
63 0.77
64 0.8
65 0.81
66 0.86
67 0.87
68 0.9
69 0.91
70 0.93
71 0.88
72 0.79
73 0.71
74 0.68
75 0.64
76 0.59
77 0.55
78 0.51
79 0.53
80 0.58
81 0.63
82 0.64
83 0.6
84 0.6
85 0.64
86 0.66
87 0.64
88 0.65