FuNGI

A0A409Y4N0

Protein Details

Accession

A0A409Y4N0

Localization Confidence

Low

Confidence Score

5.7

NoLS Segment(s)

Position	Sequence	Protein Nature
9-32	LKTSAPLRSSDRRKLKQRLVASYS	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

mito 14, plas 5, nucl 2, cyto 2, cyto_nucl 2, E.R. 2

Family & Domain DBs

InterPro	View protein in InterPro IPR039757 EIF2D IPR041366 Pre-PUA
Gene Ontology	GO:0003743 F:translation initiation factor activity GO:0001731 P:formation of translation preinitiation complex
Pfam	View protein in Pfam PF17832 Pre-PUA

Amino Acid Sequences

MFKKPLSNLKTSAPLRSSDRRKLKQRLVASYSLTPEEGDLLCPEGILSVKFSTHVGGHGVAYLDPESSDPLWFALGKHANVNPTANSNANANDREGELIPTVYTLWKKQDLLPFLSTPAAVVPILVGGADLMIPGGQFPFCLLLIIIHCPPSLPKDALVAIRQYSRKPQPQASSGSDSLPSLPVLSPPLAGKAVLVLHTWKDCLWDMGRKGDGPGDTVLTSTGSADKEEEESEESGEESDEEEEGEEGAAKDGDAASPPPPSEPSDAPSPPSQPQAGGPSSSSVPPSVSTPTIKYTPAEISSLLTLALHQAISSTLKALPPSAFPIPATQFYSNYILPSRPAFPWVVLPPSSSSSGTGTGTTNATAASSSPSKEQSDEPPRVEPEITIKSSTHKSLTAFLKSLEKSSPPLLSLKPAPSNKSDVVITAVNTTHPAVLAHKAFVTVGE

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.46
2	0.47
3	0.54
4	0.58
5	0.59
6	0.68
7	0.7
8	0.78
9	0.84
10	0.86
11	0.85
12	0.85
13	0.84
14	0.8
15	0.75
16	0.69
17	0.63
18	0.57
19	0.49
20	0.4
21	0.3
22	0.24
23	0.22
24	0.18
25	0.15
26	0.12
27	0.13
28	0.13
29	0.12
30	0.12
31	0.1
32	0.1
33	0.1
34	0.12
35	0.1
36	0.1
37	0.11
38	0.12
39	0.13
40	0.13
41	0.14
42	0.13
43	0.13
44	0.13
45	0.14
46	0.14
47	0.12
48	0.13
49	0.12
50	0.1
51	0.09
52	0.09
53	0.11
54	0.11
55	0.11
56	0.1
57	0.1
58	0.11
59	0.11
60	0.11
61	0.17
62	0.21
63	0.22
64	0.26
65	0.27
66	0.28
67	0.3
68	0.31
69	0.23
70	0.22
71	0.24
72	0.21
73	0.2
74	0.2
75	0.22
76	0.24
77	0.24
78	0.22
79	0.2
80	0.19
81	0.2
82	0.19
83	0.17
84	0.13
85	0.12
86	0.11
87	0.1
88	0.11
89	0.11
90	0.13
91	0.14
92	0.18
93	0.21
94	0.23
95	0.28
96	0.34
97	0.35
98	0.38
99	0.39
100	0.35
101	0.32
102	0.31
103	0.26
104	0.19
105	0.15
106	0.12
107	0.08
108	0.07
109	0.06
110	0.05
111	0.05
112	0.04
113	0.04
114	0.02
115	0.03
116	0.02
117	0.02
118	0.02
119	0.02
120	0.02
121	0.03
122	0.03
123	0.03
124	0.03
125	0.04
126	0.06
127	0.06
128	0.06
129	0.06
130	0.07
131	0.08
132	0.11
133	0.11
134	0.11
135	0.11
136	0.1
137	0.11
138	0.13
139	0.16
140	0.14
141	0.14
142	0.16
143	0.18
144	0.2
145	0.21
146	0.19
147	0.17
148	0.21
149	0.22
150	0.21
151	0.27
152	0.33
153	0.39
154	0.42
155	0.47
156	0.48
157	0.51
158	0.55
159	0.52
160	0.5
161	0.43
162	0.39
163	0.33
164	0.28
165	0.24
166	0.18
167	0.13
168	0.09
169	0.08
170	0.08
171	0.09
172	0.09
173	0.09
174	0.08
175	0.1
176	0.09
177	0.09
178	0.08
179	0.08
180	0.08
181	0.08
182	0.08
183	0.07
184	0.08
185	0.09
186	0.09
187	0.08
188	0.1
189	0.09
190	0.11
191	0.12
192	0.16
193	0.17
194	0.2
195	0.21
196	0.18
197	0.19
198	0.19
199	0.17
200	0.14
201	0.13
202	0.11
203	0.1
204	0.1
205	0.09
206	0.07
207	0.07
208	0.06
209	0.07
210	0.06
211	0.07
212	0.07
213	0.07
214	0.08
215	0.08
216	0.09
217	0.08
218	0.08
219	0.08
220	0.08
221	0.08
222	0.07
223	0.06
224	0.06
225	0.05
226	0.05
227	0.04
228	0.04
229	0.04
230	0.04
231	0.04
232	0.04
233	0.04
234	0.04
235	0.04
236	0.04
237	0.04
238	0.04
239	0.04
240	0.04
241	0.04
242	0.05
243	0.06
244	0.07
245	0.07
246	0.08
247	0.1
248	0.12
249	0.15
250	0.15
251	0.17
252	0.22
253	0.22
254	0.24
255	0.24
256	0.25
257	0.23
258	0.25
259	0.22
260	0.17
261	0.19
262	0.21
263	0.2
264	0.18
265	0.17
266	0.16
267	0.16
268	0.17
269	0.15
270	0.11
271	0.1
272	0.1
273	0.11
274	0.12
275	0.13
276	0.14
277	0.15
278	0.18
279	0.2
280	0.2
281	0.19
282	0.19
283	0.2
284	0.2
285	0.19
286	0.16
287	0.15
288	0.14
289	0.14
290	0.11
291	0.08
292	0.06
293	0.06
294	0.06
295	0.05
296	0.05
297	0.05
298	0.06
299	0.08
300	0.08
301	0.08
302	0.09
303	0.1
304	0.11
305	0.13
306	0.12
307	0.12
308	0.17
309	0.17
310	0.16
311	0.16
312	0.2
313	0.21
314	0.23
315	0.27
316	0.23
317	0.23
318	0.25
319	0.29
320	0.24
321	0.23
322	0.22
323	0.18
324	0.18
325	0.2
326	0.2
327	0.17
328	0.19
329	0.18
330	0.17
331	0.22
332	0.23
333	0.25
334	0.22
335	0.23
336	0.23
337	0.25
338	0.26
339	0.21
340	0.2
341	0.17
342	0.19
343	0.19
344	0.18
345	0.16
346	0.15
347	0.15
348	0.14
349	0.12
350	0.1
351	0.1
352	0.08
353	0.08
354	0.1
355	0.12
356	0.13
357	0.15
358	0.19
359	0.21
360	0.23
361	0.26
362	0.31
363	0.39
364	0.44
365	0.44
366	0.46
367	0.46
368	0.46
369	0.44
370	0.34
371	0.32
372	0.33
373	0.33
374	0.3
375	0.28
376	0.31
377	0.35
378	0.38
379	0.33
380	0.29
381	0.28
382	0.34
383	0.4
384	0.4
385	0.37
386	0.35
387	0.4
388	0.38
389	0.39
390	0.34
391	0.3
392	0.29
393	0.32
394	0.32
395	0.26
396	0.29
397	0.28
398	0.31
399	0.35
400	0.37
401	0.42
402	0.45
403	0.47
404	0.47
405	0.52
406	0.47
407	0.45
408	0.39
409	0.31
410	0.3
411	0.28
412	0.25
413	0.22
414	0.21
415	0.17
416	0.19
417	0.19
418	0.15
419	0.13
420	0.14
421	0.13
422	0.2
423	0.21
424	0.21
425	0.2
426	0.21

A0A409Y4N0

3D AlphaFold-predicted Structure Viewer