Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409Y4N0

Protein Details
Accession A0A409Y4N0    Localization Confidence Low Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
9-32LKTSAPLRSSDRRKLKQRLVASYSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, plas 5, nucl 2, cyto 2, cyto_nucl 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR039757  EIF2D  
IPR041366  Pre-PUA  
Gene Ontology GO:0003743  F:translation initiation factor activity  
GO:0001731  P:formation of translation preinitiation complex  
Pfam View protein in Pfam  
PF17832  Pre-PUA  
Amino Acid Sequences MFKKPLSNLKTSAPLRSSDRRKLKQRLVASYSLTPEEGDLLCPEGILSVKFSTHVGGHGVAYLDPESSDPLWFALGKHANVNPTANSNANANDREGELIPTVYTLWKKQDLLPFLSTPAAVVPILVGGADLMIPGGQFPFCLLLIIIHCPPSLPKDALVAIRQYSRKPQPQASSGSDSLPSLPVLSPPLAGKAVLVLHTWKDCLWDMGRKGDGPGDTVLTSTGSADKEEEESEESGEESDEEEEGEEGAAKDGDAASPPPPSEPSDAPSPPSQPQAGGPSSSSVPPSVSTPTIKYTPAEISSLLTLALHQAISSTLKALPPSAFPIPATQFYSNYILPSRPAFPWVVLPPSSSSSGTGTGTTNATAASSSPSKEQSDEPPRVEPEITIKSSTHKSLTAFLKSLEKSSPPLLSLKPAPSNKSDVVITAVNTTHPAVLAHKAFVTVGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.47
3 0.54
4 0.58
5 0.59
6 0.68
7 0.7
8 0.78
9 0.84
10 0.86
11 0.85
12 0.85
13 0.84
14 0.8
15 0.75
16 0.69
17 0.63
18 0.57
19 0.49
20 0.4
21 0.3
22 0.24
23 0.22
24 0.18
25 0.15
26 0.12
27 0.13
28 0.13
29 0.12
30 0.12
31 0.1
32 0.1
33 0.1
34 0.12
35 0.1
36 0.1
37 0.11
38 0.12
39 0.13
40 0.13
41 0.14
42 0.13
43 0.13
44 0.13
45 0.14
46 0.14
47 0.12
48 0.13
49 0.12
50 0.1
51 0.09
52 0.09
53 0.11
54 0.11
55 0.11
56 0.1
57 0.1
58 0.11
59 0.11
60 0.11
61 0.17
62 0.21
63 0.22
64 0.26
65 0.27
66 0.28
67 0.3
68 0.31
69 0.23
70 0.22
71 0.24
72 0.21
73 0.2
74 0.2
75 0.22
76 0.24
77 0.24
78 0.22
79 0.2
80 0.19
81 0.2
82 0.19
83 0.17
84 0.13
85 0.12
86 0.11
87 0.1
88 0.11
89 0.11
90 0.13
91 0.14
92 0.18
93 0.21
94 0.23
95 0.28
96 0.34
97 0.35
98 0.38
99 0.39
100 0.35
101 0.32
102 0.31
103 0.26
104 0.19
105 0.15
106 0.12
107 0.08
108 0.07
109 0.06
110 0.05
111 0.05
112 0.04
113 0.04
114 0.02
115 0.03
116 0.02
117 0.02
118 0.02
119 0.02
120 0.02
121 0.03
122 0.03
123 0.03
124 0.03
125 0.04
126 0.06
127 0.06
128 0.06
129 0.06
130 0.07
131 0.08
132 0.11
133 0.11
134 0.11
135 0.11
136 0.1
137 0.11
138 0.13
139 0.16
140 0.14
141 0.14
142 0.16
143 0.18
144 0.2
145 0.21
146 0.19
147 0.17
148 0.21
149 0.22
150 0.21
151 0.27
152 0.33
153 0.39
154 0.42
155 0.47
156 0.48
157 0.51
158 0.55
159 0.52
160 0.5
161 0.43
162 0.39
163 0.33
164 0.28
165 0.24
166 0.18
167 0.13
168 0.09
169 0.08
170 0.08
171 0.09
172 0.09
173 0.09
174 0.08
175 0.1
176 0.09
177 0.09
178 0.08
179 0.08
180 0.08
181 0.08
182 0.08
183 0.07
184 0.08
185 0.09
186 0.09
187 0.08
188 0.1
189 0.09
190 0.11
191 0.12
192 0.16
193 0.17
194 0.2
195 0.21
196 0.18
197 0.19
198 0.19
199 0.17
200 0.14
201 0.13
202 0.11
203 0.1
204 0.1
205 0.09
206 0.07
207 0.07
208 0.06
209 0.07
210 0.06
211 0.07
212 0.07
213 0.07
214 0.08
215 0.08
216 0.09
217 0.08
218 0.08
219 0.08
220 0.08
221 0.08
222 0.07
223 0.06
224 0.06
225 0.05
226 0.05
227 0.04
228 0.04
229 0.04
230 0.04
231 0.04
232 0.04
233 0.04
234 0.04
235 0.04
236 0.04
237 0.04
238 0.04
239 0.04
240 0.04
241 0.04
242 0.05
243 0.06
244 0.07
245 0.07
246 0.08
247 0.1
248 0.12
249 0.15
250 0.15
251 0.17
252 0.22
253 0.22
254 0.24
255 0.24
256 0.25
257 0.23
258 0.25
259 0.22
260 0.17
261 0.19
262 0.21
263 0.2
264 0.18
265 0.17
266 0.16
267 0.16
268 0.17
269 0.15
270 0.11
271 0.1
272 0.1
273 0.11
274 0.12
275 0.13
276 0.14
277 0.15
278 0.18
279 0.2
280 0.2
281 0.19
282 0.19
283 0.2
284 0.2
285 0.19
286 0.16
287 0.15
288 0.14
289 0.14
290 0.11
291 0.08
292 0.06
293 0.06
294 0.06
295 0.05
296 0.05
297 0.05
298 0.06
299 0.08
300 0.08
301 0.08
302 0.09
303 0.1
304 0.11
305 0.13
306 0.12
307 0.12
308 0.17
309 0.17
310 0.16
311 0.16
312 0.2
313 0.21
314 0.23
315 0.27
316 0.23
317 0.23
318 0.25
319 0.29
320 0.24
321 0.23
322 0.22
323 0.18
324 0.18
325 0.2
326 0.2
327 0.17
328 0.19
329 0.18
330 0.17
331 0.22
332 0.23
333 0.25
334 0.22
335 0.23
336 0.23
337 0.25
338 0.26
339 0.21
340 0.2
341 0.17
342 0.19
343 0.19
344 0.18
345 0.16
346 0.15
347 0.15
348 0.14
349 0.12
350 0.1
351 0.1
352 0.08
353 0.08
354 0.1
355 0.12
356 0.13
357 0.15
358 0.19
359 0.21
360 0.23
361 0.26
362 0.31
363 0.39
364 0.44
365 0.44
366 0.46
367 0.46
368 0.46
369 0.44
370 0.34
371 0.32
372 0.33
373 0.33
374 0.3
375 0.28
376 0.31
377 0.35
378 0.38
379 0.33
380 0.29
381 0.28
382 0.34
383 0.4
384 0.4
385 0.37
386 0.35
387 0.4
388 0.38
389 0.39
390 0.34
391 0.3
392 0.29
393 0.32
394 0.32
395 0.26
396 0.29
397 0.28
398 0.31
399 0.35
400 0.37
401 0.42
402 0.45
403 0.47
404 0.47
405 0.52
406 0.47
407 0.45
408 0.39
409 0.31
410 0.3
411 0.28
412 0.25
413 0.22
414 0.21
415 0.17
416 0.19
417 0.19
418 0.15
419 0.13
420 0.14
421 0.13
422 0.2
423 0.21
424 0.21
425 0.2
426 0.21