Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A409VRJ2

Protein Details
Accession A0A409VRJ2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
42-61DYWNKGKQWKDIRHRYVQEEHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 18, mito 3, golg 3, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR008027  QCR9  
IPR036656  QCR9_sf  
Gene Ontology GO:0005750  C:mitochondrial respiratory chain complex III  
GO:0006122  P:mitochondrial electron transport, ubiquinol to cytochrome c  
Pfam View protein in Pfam  
PF05365  UCR_UQCRX_QCR9  
Amino Acid Sequences MSFASTAYNAVFRRNSVFVGSVFLGAFAFGIGFDVGVTKFYDYWNKGKQWKDIRHRYVQEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.2
4 0.21
5 0.17
6 0.19
7 0.18
8 0.14
9 0.13
10 0.12
11 0.1
12 0.08
13 0.08
14 0.04
15 0.03
16 0.02
17 0.03
18 0.03
19 0.03
20 0.03
21 0.03
22 0.04
23 0.05
24 0.05
25 0.05
26 0.06
27 0.08
28 0.15
29 0.17
30 0.24
31 0.3
32 0.36
33 0.42
34 0.47
35 0.55
36 0.58
37 0.65
38 0.69
39 0.74
40 0.76
41 0.8