Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409X654

Protein Details
Accession A0A409X654    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
10-39DYRGRQRQRQAVEERRRRRRDEKGEGWWRYBasic
NLS Segment(s)
PositionSequence
22-32EERRRRRRDEK
Subcellular Location(s) plas 21, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MHCQPTGVHDYRGRQRQRQAVEERRRRRRDEKGEGWWRYIGNRRGTHGVGGPTGADKGVRAVTACMPLFFLFLFISHILLTNFVSFSLDLTIPLPWCRLYPPRREIARWGWIFPFLSTTPPPISLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.64
3 0.67
4 0.69
5 0.7
6 0.71
7 0.72
8 0.77
9 0.8
10 0.82
11 0.85
12 0.85
13 0.84
14 0.83
15 0.83
16 0.82
17 0.82
18 0.8
19 0.8
20 0.83
21 0.77
22 0.71
23 0.62
24 0.51
25 0.45
26 0.45
27 0.41
28 0.4
29 0.39
30 0.4
31 0.42
32 0.42
33 0.39
34 0.33
35 0.28
36 0.19
37 0.17
38 0.14
39 0.11
40 0.1
41 0.09
42 0.06
43 0.04
44 0.05
45 0.06
46 0.06
47 0.06
48 0.06
49 0.08
50 0.11
51 0.11
52 0.1
53 0.1
54 0.1
55 0.1
56 0.09
57 0.09
58 0.05
59 0.06
60 0.07
61 0.07
62 0.07
63 0.07
64 0.08
65 0.07
66 0.08
67 0.08
68 0.07
69 0.07
70 0.06
71 0.07
72 0.06
73 0.07
74 0.08
75 0.08
76 0.07
77 0.08
78 0.09
79 0.1
80 0.11
81 0.11
82 0.1
83 0.1
84 0.14
85 0.23
86 0.29
87 0.37
88 0.42
89 0.5
90 0.54
91 0.56
92 0.59
93 0.57
94 0.61
95 0.53
96 0.5
97 0.42
98 0.41
99 0.39
100 0.33
101 0.3
102 0.2
103 0.23
104 0.22
105 0.25
106 0.24