Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LYD3

Protein Details
Accession E2LYD3    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
79-100PKDSTHPHRIPHRRHPTPRKKPBasic
NLS Segment(s)
PositionSequence
85-100PHRIPHRRHPTPRKKP
Subcellular Location(s) nucl 12, mito 11, cyto_nucl 8.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036291  NAD(P)-bd_dom_sf  
KEGG mpr:MPER_12317  -  
Amino Acid Sequences MPPFILVTPATRGLSLALTRNLLRTTDLPVYATHRSGSPEDVKEHILSPLKDIDPNRLHLLHLDLTKESTIEDAASRIPKDSTHPHRIPHRRHPTPRKKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.19
4 0.17
5 0.19
6 0.19
7 0.22
8 0.21
9 0.19
10 0.19
11 0.16
12 0.2
13 0.2
14 0.2
15 0.19
16 0.19
17 0.23
18 0.22
19 0.22
20 0.17
21 0.15
22 0.18
23 0.18
24 0.21
25 0.21
26 0.21
27 0.22
28 0.23
29 0.23
30 0.21
31 0.21
32 0.2
33 0.19
34 0.16
35 0.16
36 0.18
37 0.16
38 0.19
39 0.19
40 0.24
41 0.22
42 0.25
43 0.26
44 0.23
45 0.23
46 0.21
47 0.23
48 0.18
49 0.18
50 0.16
51 0.14
52 0.14
53 0.14
54 0.14
55 0.11
56 0.08
57 0.07
58 0.07
59 0.07
60 0.06
61 0.09
62 0.13
63 0.13
64 0.14
65 0.14
66 0.14
67 0.2
68 0.29
69 0.35
70 0.43
71 0.46
72 0.51
73 0.62
74 0.71
75 0.74
76 0.75
77 0.78
78 0.78
79 0.86
80 0.91