Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409VFH7

Protein Details
Accession A0A409VFH7    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
27-69TESADKKQPPPLPPNKKQKIDLRPAPIKPKPPPPPTPKIPRSFHydrophilic
NLS Segment(s)
PositionSequence
33-67KQPPPLPPNKKQKIDLRPAPIKPKPPPPPTPKIPR
Subcellular Location(s) mito 12, plas 4, nucl 3.5, cyto_nucl 3.5, extr 3, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR033122  LETM1-like_RBD  
IPR044202  LETM1/MDM38-like  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0043022  F:ribosome binding  
Pfam View protein in Pfam  
PF07766  LETM1_RBD  
PROSITE View protein in PROSITE  
PS51758  LETM1_RBD  
Amino Acid Sequences MLRAVARQSAHRVVFAAVRPYSIPTPTESADKKQPPPLPPNKKQKIDLRPAPIKPKPPPPPTPKIPRSFPQASHGLPPAPKLDAAKQEVLHDLQDAEKHGILTPAPPDANWFKKTLHQLIQLMKFYYRGVKLIFSRRKEIAIIKARIKAGGPPLTRVEFRLIETQKDDINKVVPFLIIALVLEEIIPLIAIYAPFLLPSTCILPSQRERIEAKRAEKAAAFMTQYYTTFGELVRAEQPKGFLSLSALSTVPSAPTAVCGLLGLSTIGFDALRIRRIRRHLEFITRDDQLLLQDNKTLSHREVVEALEERGIASQNMSPADAQSRLSRWLDAVKDSSSQVDDDALARRLYLIVYSHS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.34
3 0.34
4 0.26
5 0.27
6 0.26
7 0.29
8 0.3
9 0.27
10 0.25
11 0.21
12 0.25
13 0.25
14 0.33
15 0.32
16 0.35
17 0.43
18 0.49
19 0.5
20 0.55
21 0.6
22 0.59
23 0.67
24 0.72
25 0.73
26 0.75
27 0.82
28 0.83
29 0.83
30 0.83
31 0.83
32 0.82
33 0.82
34 0.8
35 0.79
36 0.78
37 0.77
38 0.79
39 0.75
40 0.73
41 0.69
42 0.71
43 0.72
44 0.71
45 0.75
46 0.75
47 0.78
48 0.79
49 0.83
50 0.81
51 0.78
52 0.76
53 0.71
54 0.71
55 0.68
56 0.61
57 0.56
58 0.53
59 0.47
60 0.45
61 0.42
62 0.37
63 0.31
64 0.31
65 0.27
66 0.22
67 0.22
68 0.2
69 0.23
70 0.27
71 0.31
72 0.33
73 0.31
74 0.32
75 0.33
76 0.31
77 0.26
78 0.19
79 0.15
80 0.13
81 0.13
82 0.14
83 0.13
84 0.13
85 0.13
86 0.13
87 0.14
88 0.12
89 0.13
90 0.12
91 0.13
92 0.12
93 0.12
94 0.15
95 0.2
96 0.26
97 0.26
98 0.27
99 0.25
100 0.31
101 0.37
102 0.39
103 0.39
104 0.39
105 0.41
106 0.46
107 0.5
108 0.46
109 0.41
110 0.35
111 0.3
112 0.25
113 0.25
114 0.2
115 0.16
116 0.15
117 0.18
118 0.23
119 0.32
120 0.39
121 0.37
122 0.41
123 0.4
124 0.41
125 0.39
126 0.38
127 0.37
128 0.39
129 0.4
130 0.39
131 0.42
132 0.41
133 0.39
134 0.36
135 0.29
136 0.26
137 0.29
138 0.26
139 0.25
140 0.27
141 0.28
142 0.28
143 0.27
144 0.24
145 0.18
146 0.19
147 0.25
148 0.23
149 0.23
150 0.24
151 0.24
152 0.22
153 0.22
154 0.21
155 0.13
156 0.15
157 0.14
158 0.13
159 0.12
160 0.1
161 0.08
162 0.08
163 0.07
164 0.04
165 0.04
166 0.04
167 0.03
168 0.03
169 0.03
170 0.03
171 0.02
172 0.02
173 0.02
174 0.02
175 0.02
176 0.02
177 0.02
178 0.03
179 0.03
180 0.03
181 0.03
182 0.04
183 0.04
184 0.04
185 0.05
186 0.07
187 0.07
188 0.08
189 0.09
190 0.13
191 0.17
192 0.23
193 0.23
194 0.26
195 0.28
196 0.32
197 0.4
198 0.41
199 0.41
200 0.41
201 0.41
202 0.38
203 0.35
204 0.33
205 0.26
206 0.22
207 0.19
208 0.13
209 0.15
210 0.14
211 0.14
212 0.14
213 0.13
214 0.11
215 0.11
216 0.1
217 0.12
218 0.11
219 0.12
220 0.16
221 0.17
222 0.17
223 0.17
224 0.19
225 0.16
226 0.19
227 0.17
228 0.11
229 0.12
230 0.14
231 0.13
232 0.13
233 0.13
234 0.11
235 0.11
236 0.11
237 0.09
238 0.07
239 0.07
240 0.05
241 0.07
242 0.07
243 0.07
244 0.07
245 0.06
246 0.06
247 0.06
248 0.06
249 0.05
250 0.04
251 0.04
252 0.04
253 0.04
254 0.04
255 0.04
256 0.09
257 0.11
258 0.18
259 0.21
260 0.24
261 0.31
262 0.39
263 0.48
264 0.48
265 0.55
266 0.54
267 0.61
268 0.63
269 0.61
270 0.59
271 0.5
272 0.45
273 0.37
274 0.32
275 0.24
276 0.27
277 0.23
278 0.19
279 0.22
280 0.22
281 0.23
282 0.25
283 0.26
284 0.2
285 0.23
286 0.24
287 0.22
288 0.24
289 0.22
290 0.25
291 0.23
292 0.22
293 0.18
294 0.17
295 0.15
296 0.14
297 0.14
298 0.1
299 0.1
300 0.11
301 0.13
302 0.14
303 0.15
304 0.14
305 0.14
306 0.18
307 0.18
308 0.18
309 0.19
310 0.21
311 0.26
312 0.27
313 0.26
314 0.24
315 0.29
316 0.3
317 0.3
318 0.31
319 0.28
320 0.29
321 0.29
322 0.29
323 0.24
324 0.22
325 0.18
326 0.16
327 0.15
328 0.15
329 0.18
330 0.18
331 0.17
332 0.16
333 0.16
334 0.16
335 0.15
336 0.15