Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409W0V0

Protein Details
Accession A0A409W0V0    Localization Confidence High Confidence Score 20
NoLS Segment(s)
PositionSequenceProtein Nature
35-57TSTAPVKRGRGRPKGSKNKKSGAHydrophilic
65-127STPSVPRKRGRPPKEKKEDTGEEPPPKRPRGRPPKHPKPPAGETPATTEPTEKKKRGRPKKTTBasic
NLS Segment(s)
PositionSequence
41-126KRGRGRPKGSKNKKSGASSSTAQPSTPSVPRKRGRPPKEKKEDTGEEPPPKRPRGRPPKHPKPPAGETPATTEPTEKKKRGRPKKT
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
IPR000116  HMGA  
Gene Ontology GO:0000785  C:chromatin  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF02178  AT_hook  
Amino Acid Sequences MSTSPKDVQDEGADKQSVDELADPNHATDDAEAGTSTAPVKRGRGRPKGSKNKKSGASSSTAQPSTPSVPRKRGRPPKEKKEDTGEEPPPKRPRGRPPKHPKPPAGETPATTEPTEKKKRGRPKKTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.26
3 0.25
4 0.19
5 0.16
6 0.16
7 0.11
8 0.13
9 0.16
10 0.16
11 0.14
12 0.15
13 0.14
14 0.12
15 0.1
16 0.1
17 0.07
18 0.07
19 0.07
20 0.06
21 0.06
22 0.06
23 0.07
24 0.07
25 0.1
26 0.11
27 0.16
28 0.23
29 0.32
30 0.41
31 0.5
32 0.56
33 0.64
34 0.74
35 0.81
36 0.84
37 0.85
38 0.82
39 0.79
40 0.78
41 0.71
42 0.64
43 0.54
44 0.48
45 0.4
46 0.37
47 0.34
48 0.27
49 0.23
50 0.2
51 0.19
52 0.18
53 0.22
54 0.26
55 0.25
56 0.35
57 0.38
58 0.45
59 0.54
60 0.61
61 0.66
62 0.7
63 0.77
64 0.79
65 0.86
66 0.84
67 0.78
68 0.76
69 0.71
70 0.66
71 0.64
72 0.61
73 0.59
74 0.56
75 0.6
76 0.58
77 0.58
78 0.58
79 0.57
80 0.61
81 0.64
82 0.72
83 0.75
84 0.79
85 0.86
86 0.9
87 0.91
88 0.87
89 0.84
90 0.82
91 0.79
92 0.76
93 0.67
94 0.58
95 0.56
96 0.53
97 0.47
98 0.4
99 0.35
100 0.33
101 0.4
102 0.48
103 0.47
104 0.53
105 0.6
106 0.71
107 0.79