Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8JPS9

Protein Details
Accession G8JPS9    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
179-205RTLSRAERKKLIKKNELQHKRNLKNSMHydrophilic
NLS Segment(s)
PositionSequence
104-131EKPLPKPKAPTKWELFAAKKNIKPKERA
185-198ERKKLIKKNELQHK
Subcellular Location(s) nucl 17, cyto 5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007023  Ribosom_reg  
Gene Ontology GO:0005634  C:nucleus  
GO:0042254  P:ribosome biogenesis  
KEGG erc:Ecym_2460  -  
Pfam View protein in Pfam  
PF04939  RRS1  
Amino Acid Sequences MSGNSTSASSLPVTVEKPIPVTYDMGNLAVFDTNTLDKNDLDSSNGAREEHLKSLTRDNMQLMINQILSLPIKTTTEATGGTSGQSATVTLIQLPQPTTELPREKPLPKPKAPTKWELFAAKKNIKPKERAGKMVYDEASGEWAPKWGYKGINKKLDDQWLVEVDDKVKGTDDELIDPRTLSRAERKKLIKKNELQHKRNLKNSMGLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.19
3 0.18
4 0.2
5 0.2
6 0.21
7 0.2
8 0.2
9 0.18
10 0.2
11 0.2
12 0.18
13 0.16
14 0.14
15 0.13
16 0.12
17 0.11
18 0.08
19 0.09
20 0.1
21 0.12
22 0.13
23 0.13
24 0.12
25 0.15
26 0.18
27 0.16
28 0.17
29 0.17
30 0.17
31 0.2
32 0.21
33 0.18
34 0.16
35 0.19
36 0.2
37 0.22
38 0.23
39 0.22
40 0.23
41 0.3
42 0.34
43 0.33
44 0.31
45 0.29
46 0.3
47 0.27
48 0.27
49 0.22
50 0.18
51 0.16
52 0.14
53 0.13
54 0.11
55 0.1
56 0.09
57 0.08
58 0.07
59 0.08
60 0.09
61 0.1
62 0.09
63 0.1
64 0.1
65 0.11
66 0.11
67 0.1
68 0.1
69 0.09
70 0.08
71 0.07
72 0.07
73 0.06
74 0.05
75 0.06
76 0.05
77 0.05
78 0.07
79 0.07
80 0.08
81 0.09
82 0.08
83 0.08
84 0.09
85 0.11
86 0.15
87 0.18
88 0.18
89 0.22
90 0.26
91 0.28
92 0.36
93 0.44
94 0.47
95 0.47
96 0.55
97 0.57
98 0.63
99 0.64
100 0.63
101 0.57
102 0.52
103 0.52
104 0.49
105 0.44
106 0.4
107 0.44
108 0.42
109 0.42
110 0.46
111 0.5
112 0.49
113 0.51
114 0.54
115 0.57
116 0.56
117 0.59
118 0.54
119 0.51
120 0.49
121 0.49
122 0.41
123 0.31
124 0.27
125 0.2
126 0.21
127 0.15
128 0.13
129 0.08
130 0.09
131 0.09
132 0.1
133 0.12
134 0.13
135 0.18
136 0.25
137 0.36
138 0.43
139 0.52
140 0.52
141 0.56
142 0.57
143 0.59
144 0.54
145 0.45
146 0.4
147 0.33
148 0.33
149 0.29
150 0.25
151 0.19
152 0.2
153 0.18
154 0.15
155 0.14
156 0.13
157 0.12
158 0.16
159 0.17
160 0.19
161 0.21
162 0.23
163 0.22
164 0.22
165 0.21
166 0.19
167 0.18
168 0.17
169 0.25
170 0.32
171 0.37
172 0.46
173 0.55
174 0.63
175 0.71
176 0.78
177 0.78
178 0.78
179 0.83
180 0.85
181 0.87
182 0.81
183 0.82
184 0.83
185 0.81
186 0.81
187 0.77
188 0.69