Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409Y1D4

Protein Details
Accession A0A409Y1D4    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MSSNNASKKKKTKAQRCNICEDWHydrophilic
NLS Segment(s)
PositionSequence
56-68GNKGDGNKSGGKK
Subcellular Location(s) nucl 16.5, mito_nucl 13.666, cyto_nucl 9.833, mito 9.5
Family & Domain DBs
Amino Acid Sequences MSSNNASKKKKTKAQRCNICEDWASTGGGHVCKGAKELREWGGNSSRSAQVNKKSGNKGDGNKSGGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.89
3 0.84
4 0.83
5 0.77
6 0.69
7 0.59
8 0.49
9 0.42
10 0.32
11 0.28
12 0.18
13 0.17
14 0.15
15 0.14
16 0.12
17 0.09
18 0.08
19 0.08
20 0.1
21 0.12
22 0.11
23 0.12
24 0.16
25 0.18
26 0.21
27 0.22
28 0.23
29 0.28
30 0.28
31 0.28
32 0.27
33 0.28
34 0.27
35 0.3
36 0.33
37 0.34
38 0.4
39 0.46
40 0.51
41 0.53
42 0.56
43 0.59
44 0.6
45 0.6
46 0.62
47 0.62
48 0.59