Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8JWR3

Protein Details
Accession G8JWR3    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MAAATATKKRTQRKKKDPNAPKRAMSAHydrophilic
NLS Segment(s)
PositionSequence
8-23KKRTQRKKKDPNAPKR
Subcellular Location(s) nucl 21, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
KEGG erc:Ecym_7459  -  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MAAATATKKRTQRKKKDPNAPKRAMSAYMFFANENRDIVRAENPGISFGQVGRVLGEKWKALSDDEKQPYEAKAEADKKRYESEKELYNATKAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.9
3 0.94
4 0.94
5 0.95
6 0.94
7 0.89
8 0.8
9 0.74
10 0.66
11 0.58
12 0.49
13 0.4
14 0.32
15 0.28
16 0.26
17 0.21
18 0.2
19 0.18
20 0.17
21 0.15
22 0.12
23 0.11
24 0.11
25 0.12
26 0.13
27 0.13
28 0.13
29 0.14
30 0.13
31 0.13
32 0.13
33 0.12
34 0.09
35 0.08
36 0.1
37 0.08
38 0.08
39 0.08
40 0.08
41 0.08
42 0.1
43 0.12
44 0.09
45 0.1
46 0.11
47 0.11
48 0.12
49 0.16
50 0.19
51 0.27
52 0.31
53 0.31
54 0.31
55 0.32
56 0.31
57 0.29
58 0.26
59 0.19
60 0.23
61 0.31
62 0.36
63 0.41
64 0.43
65 0.44
66 0.5
67 0.52
68 0.5
69 0.48
70 0.47
71 0.49
72 0.48
73 0.51
74 0.46