Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8JV12

Protein Details
Accession G8JV12    Localization Confidence Low Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
16-44LWKIPWRMSTPQKQRQRKRLKAVDKVLSQHydrophilic
105-133NRYSKQYRKGIHKVPKWTKVSNRSNPKNFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, mito_nucl 13.5, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
KEGG erc:Ecym_6095  -  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFRSSQPLLGGLLWKIPWRMSTPQKQRQRKRLKAVDKVLSQLNLGLYIKSAIEKNPAATVTELLHVKNYKYNGIKQLNTLNDPSVFPSESQMSYKDKYTIFNRYSKQYRKGIHKVPKWTKVSNRSNPKNF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.17
4 0.17
5 0.16
6 0.15
7 0.16
8 0.19
9 0.27
10 0.34
11 0.44
12 0.52
13 0.61
14 0.71
15 0.79
16 0.85
17 0.88
18 0.9
19 0.89
20 0.89
21 0.9
22 0.89
23 0.88
24 0.86
25 0.83
26 0.73
27 0.66
28 0.57
29 0.47
30 0.38
31 0.29
32 0.2
33 0.15
34 0.13
35 0.1
36 0.08
37 0.08
38 0.08
39 0.08
40 0.08
41 0.07
42 0.11
43 0.11
44 0.12
45 0.13
46 0.13
47 0.13
48 0.13
49 0.13
50 0.1
51 0.12
52 0.11
53 0.1
54 0.12
55 0.12
56 0.12
57 0.14
58 0.14
59 0.17
60 0.19
61 0.23
62 0.3
63 0.34
64 0.34
65 0.34
66 0.38
67 0.36
68 0.35
69 0.32
70 0.25
71 0.21
72 0.2
73 0.2
74 0.16
75 0.14
76 0.12
77 0.14
78 0.15
79 0.15
80 0.16
81 0.17
82 0.19
83 0.2
84 0.22
85 0.23
86 0.22
87 0.26
88 0.29
89 0.36
90 0.36
91 0.42
92 0.43
93 0.48
94 0.57
95 0.59
96 0.62
97 0.61
98 0.65
99 0.68
100 0.74
101 0.75
102 0.76
103 0.76
104 0.79
105 0.81
106 0.83
107 0.79
108 0.78
109 0.78
110 0.78
111 0.82
112 0.81
113 0.82