Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8JUJ5

Protein Details
Accession G8JUJ5   
Localization Confidence Low
Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-32VNVPKTRKTYCKGKSCRKHTQHKVTQYKAGKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 9.5, mito 9, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG erc:Ecym_6401  -  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNVPKTRKTYCKGKSCRKHTQHKVTQYKAGKASLFAQGKRRYDRKQCGYGGQTKQIFHKKAKTTKKVVLRLECVNCKTKAQLPLKRCKHFELGGEKKQKGQALQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.83
3 0.84
4 0.89
5 0.88
6 0.89
7 0.89
8 0.9
9 0.88
10 0.89
11 0.89
12 0.82
13 0.82
14 0.76
15 0.7
16 0.62
17 0.56
18 0.45
19 0.37
20 0.35
21 0.34
22 0.33
23 0.29
24 0.34
25 0.38
26 0.42
27 0.47
28 0.52
29 0.51
30 0.57
31 0.65
32 0.64
33 0.64
34 0.61
35 0.6
36 0.57
37 0.58
38 0.5
39 0.47
40 0.42
41 0.35
42 0.39
43 0.41
44 0.41
45 0.36
46 0.42
47 0.43
48 0.5
49 0.6
50 0.62
51 0.61
52 0.65
53 0.71
54 0.71
55 0.7
56 0.66
57 0.61
58 0.6
59 0.59
60 0.57
61 0.51
62 0.48
63 0.42
64 0.38
65 0.37
66 0.35
67 0.39
68 0.43
69 0.48
70 0.51
71 0.61
72 0.69
73 0.73
74 0.71
75 0.66
76 0.63
77 0.59
78 0.59
79 0.59
80 0.59
81 0.61
82 0.66
83 0.62
84 0.6
85 0.61
86 0.57