Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A409WH76

Protein Details
Accession A0A409WH76    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
46-70PWIGRPDRHRDTRRRSRPPPSPGNSBasic
NLS Segment(s)
PositionSequence
48-64IGRPDRHRDTRRRSRPP
Subcellular Location(s) nucl 19, cyto_nucl 12.5, cyto 4, mito 2
Family & Domain DBs
Amino Acid Sequences MRVLLPHLPSPSHPPPSFDTAAPPFNPSTRMWARIRRVWVCWKRGPWIGRPDRHRDTRRRSRPPPSPGNSEPEIDDLPFLLTTSPPSPSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.42
3 0.48
4 0.48
5 0.39
6 0.38
7 0.33
8 0.37
9 0.33
10 0.31
11 0.25
12 0.24
13 0.26
14 0.2
15 0.25
16 0.24
17 0.29
18 0.31
19 0.38
20 0.42
21 0.44
22 0.51
23 0.45
24 0.46
25 0.51
26 0.54
27 0.52
28 0.51
29 0.48
30 0.45
31 0.49
32 0.47
33 0.42
34 0.46
35 0.47
36 0.49
37 0.52
38 0.56
39 0.58
40 0.65
41 0.67
42 0.66
43 0.69
44 0.74
45 0.79
46 0.81
47 0.82
48 0.83
49 0.84
50 0.84
51 0.84
52 0.78
53 0.76
54 0.69
55 0.67
56 0.59
57 0.51
58 0.43
59 0.36
60 0.31
61 0.22
62 0.2
63 0.14
64 0.13
65 0.12
66 0.11
67 0.08
68 0.07
69 0.11
70 0.13