Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409WTA4

Protein Details
Accession A0A409WTA4    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
15-37EEEREGARRKWRRVKLTHRIGTGBasic
NLS Segment(s)
PositionSequence
22-27RRKWRR
Subcellular Location(s) cyto 12, nucl 9, mito 3, extr 2
Family & Domain DBs
Amino Acid Sequences MVSPVGCLRDREEEEEEREGARRKWRRVKLTHRIGTGATLAHQLGGAVAGLGSKDLRNVVAHNHAQDTPHPTRTRRRHT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.41
3 0.38
4 0.3
5 0.31
6 0.29
7 0.28
8 0.34
9 0.38
10 0.45
11 0.54
12 0.62
13 0.68
14 0.74
15 0.81
16 0.82
17 0.85
18 0.81
19 0.71
20 0.64
21 0.55
22 0.46
23 0.35
24 0.25
25 0.14
26 0.1
27 0.08
28 0.07
29 0.07
30 0.05
31 0.04
32 0.04
33 0.04
34 0.02
35 0.02
36 0.02
37 0.02
38 0.03
39 0.04
40 0.04
41 0.04
42 0.05
43 0.06
44 0.08
45 0.09
46 0.12
47 0.19
48 0.22
49 0.23
50 0.25
51 0.25
52 0.25
53 0.28
54 0.33
55 0.3
56 0.36
57 0.39
58 0.41
59 0.52