Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8JTL3

Protein Details
Accession G8JTL3    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
84-109LARARSKTGQKILKRRKEKGRWYLTYHydrophilic
NLS Segment(s)
PositionSequence
75-104LKRKRRVGFLARARSKTGQKILKRRKEKGR
Subcellular Location(s) mito 24, nucl 1.5, cyto_nucl 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG erc:Ecym_4303  -  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MLYKSRSLLQWFPRRSLVTLVSSFSPMKSLVQPLATSAANTSVSTFQRPSVISLVFGLNQRRWKSRGNTFQPSTLKRKRRVGFLARARSKTGQKILKRRKEKGRWYLTY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.5
3 0.48
4 0.41
5 0.37
6 0.35
7 0.33
8 0.28
9 0.28
10 0.26
11 0.21
12 0.19
13 0.14
14 0.14
15 0.15
16 0.16
17 0.15
18 0.17
19 0.17
20 0.16
21 0.18
22 0.16
23 0.14
24 0.12
25 0.12
26 0.11
27 0.11
28 0.11
29 0.12
30 0.13
31 0.15
32 0.15
33 0.13
34 0.15
35 0.16
36 0.17
37 0.15
38 0.15
39 0.13
40 0.13
41 0.13
42 0.12
43 0.14
44 0.14
45 0.14
46 0.2
47 0.22
48 0.25
49 0.27
50 0.32
51 0.37
52 0.44
53 0.52
54 0.54
55 0.6
56 0.59
57 0.63
58 0.63
59 0.61
60 0.61
61 0.6
62 0.61
63 0.6
64 0.68
65 0.65
66 0.67
67 0.71
68 0.7
69 0.71
70 0.73
71 0.76
72 0.72
73 0.71
74 0.67
75 0.64
76 0.61
77 0.58
78 0.57
79 0.55
80 0.58
81 0.67
82 0.74
83 0.79
84 0.83
85 0.84
86 0.87
87 0.88
88 0.9
89 0.9