Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A409WL76

Protein Details
Accession A0A409WL76    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MPRGPIFPRRRRRRRGPPAWVNTNVAHydrophilic
NLS Segment(s)
PositionSequence
8-17PRRRRRRRGP
Subcellular Location(s) nucl 15.5, mito 10, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MPRGPIFPRRRRRRRGPPAWVNTNVANGGQAPGAAAAGAGGASNSPTGETPVTASQLAAPLARSAVAGSSSRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.94
3 0.93
4 0.93
5 0.91
6 0.88
7 0.8
8 0.72
9 0.61
10 0.52
11 0.41
12 0.3
13 0.21
14 0.14
15 0.11
16 0.08
17 0.07
18 0.05
19 0.04
20 0.04
21 0.04
22 0.03
23 0.02
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.02
30 0.03
31 0.03
32 0.03
33 0.04
34 0.06
35 0.06
36 0.07
37 0.09
38 0.1
39 0.12
40 0.12
41 0.12
42 0.11
43 0.13
44 0.13
45 0.11
46 0.1
47 0.09
48 0.09
49 0.09
50 0.09
51 0.07
52 0.08
53 0.1