Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409WEL1

Protein Details
Accession A0A409WEL1    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
119-147RIGATSSQKAKKKRGRPRKAQEDEGRDESBasic
NLS Segment(s)
PositionSequence
127-138KAKKKRGRPRKA
Subcellular Location(s) cyto_nucl 14.666, nucl 13.5, cyto 9.5, mito_nucl 9.331, cyto_mito 7.331
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
IPR041232  NPL  
Gene Ontology GO:0003677  F:DNA binding  
GO:0016853  F:isomerase activity  
Pfam View protein in Pfam  
PF02178  AT_hook  
PF17800  NPL  
Amino Acid Sequences MSDMQATGLWSLLLEPKKGIYVEPGSHLRVTNVALAFQCTDVQADTRLIVGYVPGGSKSGEKIRTVVANFTVAYTEQVRFTHFDLSPNTEYYFEADGPNPIQLLGYYSGEVDSGTGTTRIGATSSQKAKKKRGRPRKAQEDEGRDES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.16
4 0.19
5 0.19
6 0.19
7 0.18
8 0.22
9 0.23
10 0.27
11 0.3
12 0.29
13 0.31
14 0.31
15 0.25
16 0.21
17 0.21
18 0.2
19 0.17
20 0.16
21 0.15
22 0.16
23 0.16
24 0.15
25 0.14
26 0.09
27 0.09
28 0.08
29 0.09
30 0.09
31 0.09
32 0.08
33 0.09
34 0.08
35 0.08
36 0.07
37 0.06
38 0.05
39 0.05
40 0.05
41 0.05
42 0.06
43 0.06
44 0.07
45 0.09
46 0.14
47 0.16
48 0.16
49 0.17
50 0.18
51 0.21
52 0.21
53 0.2
54 0.15
55 0.14
56 0.14
57 0.13
58 0.11
59 0.08
60 0.09
61 0.09
62 0.09
63 0.09
64 0.09
65 0.1
66 0.11
67 0.12
68 0.16
69 0.15
70 0.18
71 0.19
72 0.24
73 0.25
74 0.25
75 0.24
76 0.19
77 0.19
78 0.18
79 0.18
80 0.13
81 0.13
82 0.12
83 0.13
84 0.12
85 0.13
86 0.1
87 0.08
88 0.08
89 0.06
90 0.09
91 0.09
92 0.09
93 0.09
94 0.09
95 0.1
96 0.1
97 0.09
98 0.07
99 0.05
100 0.05
101 0.05
102 0.06
103 0.06
104 0.06
105 0.06
106 0.07
107 0.07
108 0.09
109 0.13
110 0.21
111 0.3
112 0.37
113 0.44
114 0.51
115 0.61
116 0.69
117 0.75
118 0.78
119 0.81
120 0.84
121 0.89
122 0.93
123 0.94
124 0.92
125 0.92
126 0.9
127 0.87