Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409WQ36

Protein Details
Accession A0A409WQ36    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
12-42STCQHKHKAAVVSNKKKKKKNNNNKDIFNNMHydrophilic
NLS Segment(s)
PositionSequence
25-31NKKKKKK
Subcellular Location(s) nucl 18, cyto_nucl 11.5, mito 6
Family & Domain DBs
Amino Acid Sequences MSSHSSACLSPSTCQHKHKAAVVSNKKKKKKNNNNKDIFNNMDFIASWLRNVGLADDQRSNEHPASEGESIQGLPEPSPPAACLPDTSPTSPSPPAILQQVHSQLNSTVQLRRRKGRYTFYTVTVGRRTGIFRDW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.5
3 0.53
4 0.56
5 0.59
6 0.59
7 0.58
8 0.62
9 0.68
10 0.73
11 0.75
12 0.81
13 0.83
14 0.82
15 0.86
16 0.86
17 0.87
18 0.87
19 0.89
20 0.9
21 0.9
22 0.89
23 0.84
24 0.78
25 0.7
26 0.6
27 0.5
28 0.39
29 0.3
30 0.23
31 0.19
32 0.17
33 0.12
34 0.11
35 0.1
36 0.09
37 0.1
38 0.1
39 0.09
40 0.09
41 0.1
42 0.12
43 0.14
44 0.14
45 0.15
46 0.17
47 0.2
48 0.16
49 0.15
50 0.14
51 0.13
52 0.16
53 0.16
54 0.14
55 0.11
56 0.1
57 0.1
58 0.09
59 0.09
60 0.06
61 0.05
62 0.07
63 0.08
64 0.08
65 0.08
66 0.08
67 0.09
68 0.1
69 0.1
70 0.1
71 0.1
72 0.14
73 0.16
74 0.17
75 0.18
76 0.18
77 0.21
78 0.21
79 0.2
80 0.18
81 0.16
82 0.17
83 0.19
84 0.19
85 0.17
86 0.22
87 0.27
88 0.26
89 0.25
90 0.24
91 0.2
92 0.22
93 0.23
94 0.2
95 0.2
96 0.26
97 0.35
98 0.41
99 0.49
100 0.53
101 0.58
102 0.63
103 0.68
104 0.69
105 0.7
106 0.67
107 0.63
108 0.64
109 0.58
110 0.56
111 0.5
112 0.43
113 0.34
114 0.33
115 0.31