Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A409W5R5

Protein Details
Accession A0A409W5R5    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
10-36ASSGGKAAKKKKWSKGKVKDKAQHAVSHydrophilic
NLS Segment(s)
PositionSequence
6-30AAPAASSGGKAAKKKKWSKGKVKDK
Subcellular Location(s) nucl 17, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKAKAAPAASSGGKAAKKKKWSKGKVKDKAQHAVSLDKATYDRILKEVPTFKFISQSILIERLKINGSLARVAIRHLEKEKLIKRIVHHSAQLIYTRATASD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.29
3 0.35
4 0.38
5 0.48
6 0.57
7 0.65
8 0.71
9 0.78
10 0.83
11 0.86
12 0.9
13 0.9
14 0.91
15 0.88
16 0.84
17 0.81
18 0.72
19 0.65
20 0.55
21 0.48
22 0.39
23 0.34
24 0.27
25 0.19
26 0.18
27 0.15
28 0.15
29 0.13
30 0.11
31 0.11
32 0.12
33 0.12
34 0.16
35 0.21
36 0.19
37 0.22
38 0.23
39 0.21
40 0.24
41 0.23
42 0.23
43 0.17
44 0.18
45 0.15
46 0.19
47 0.19
48 0.17
49 0.17
50 0.15
51 0.15
52 0.14
53 0.14
54 0.11
55 0.12
56 0.12
57 0.13
58 0.13
59 0.12
60 0.13
61 0.18
62 0.17
63 0.2
64 0.22
65 0.24
66 0.25
67 0.34
68 0.39
69 0.4
70 0.43
71 0.42
72 0.43
73 0.5
74 0.54
75 0.49
76 0.47
77 0.43
78 0.42
79 0.41
80 0.4
81 0.32
82 0.27
83 0.23