Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409Y5I6

Protein Details
Accession A0A409Y5I6    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MPPKTKKPRKSKVEPPPTPEGFBasic
NLS Segment(s)
PositionSequence
5-12TKKPRKSK
Subcellular Location(s) nucl 18.5, mito_nucl 12.666, cyto_nucl 11.833, mito 5.5
Family & Domain DBs
Amino Acid Sequences MPPKTKKPRKSKVEPPPTPEGFTQITGPRASKYMVPNYLVPATHQALAGYSQCLDEEVFNLSPINQNMEKQVSIKMGETSIRLPCDPLPSLRECLQAHAEVIGVQQHLGLSYKDAAHRLYHAEYAKILAHDQSVKALSTLTGLCLKSIEKVEAELSLALGDGSGRAKSNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.84
3 0.83
4 0.75
5 0.68
6 0.58
7 0.51
8 0.42
9 0.36
10 0.33
11 0.27
12 0.27
13 0.26
14 0.27
15 0.23
16 0.22
17 0.22
18 0.23
19 0.25
20 0.3
21 0.32
22 0.33
23 0.33
24 0.35
25 0.37
26 0.32
27 0.27
28 0.24
29 0.22
30 0.21
31 0.2
32 0.16
33 0.14
34 0.16
35 0.15
36 0.11
37 0.09
38 0.08
39 0.08
40 0.09
41 0.08
42 0.07
43 0.07
44 0.09
45 0.09
46 0.09
47 0.1
48 0.09
49 0.12
50 0.12
51 0.16
52 0.13
53 0.14
54 0.16
55 0.17
56 0.17
57 0.15
58 0.17
59 0.14
60 0.14
61 0.14
62 0.12
63 0.11
64 0.12
65 0.12
66 0.12
67 0.13
68 0.13
69 0.12
70 0.12
71 0.12
72 0.15
73 0.15
74 0.14
75 0.15
76 0.16
77 0.19
78 0.2
79 0.25
80 0.21
81 0.23
82 0.24
83 0.21
84 0.19
85 0.16
86 0.15
87 0.09
88 0.09
89 0.08
90 0.06
91 0.05
92 0.05
93 0.05
94 0.06
95 0.07
96 0.06
97 0.06
98 0.08
99 0.1
100 0.11
101 0.12
102 0.13
103 0.13
104 0.14
105 0.16
106 0.16
107 0.2
108 0.19
109 0.19
110 0.18
111 0.19
112 0.19
113 0.17
114 0.15
115 0.11
116 0.13
117 0.14
118 0.14
119 0.15
120 0.14
121 0.14
122 0.13
123 0.13
124 0.11
125 0.11
126 0.11
127 0.11
128 0.14
129 0.14
130 0.14
131 0.15
132 0.16
133 0.17
134 0.2
135 0.19
136 0.15
137 0.17
138 0.18
139 0.17
140 0.18
141 0.14
142 0.12
143 0.1
144 0.09
145 0.07
146 0.06
147 0.05
148 0.05
149 0.07
150 0.08