Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8JQT0

Protein Details
Accession G8JQT0    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MESIKKAERRIAKKKQVYKAILDHydrophilic
NLS Segment(s)
PositionSequence
8-14ERRIAKK
Subcellular Location(s) cyto 15, mito 7.5, mito_nucl 5.5, nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013241  RNase_P_Pop3  
Gene Ontology GO:0006364  P:rRNA processing  
GO:0008033  P:tRNA processing  
KEGG erc:Ecym_3599  -  
Pfam View protein in Pfam  
PF08228  RNase_P_pop3  
Amino Acid Sequences MESIKKAERRIAKKKQVYKAILDNAYANDGQLWPLVDEQGLVVELLDKTILRPLKHSSHLGASEKPVQVVTGYNEVMEFLTGACADEGLKEVFLFVCNKDLAGVLVEQIPIAAYMSRYDVCLVQLPKGSLARFTECLEGIAHDGLLLVPVVKDGLDKTFTSKIRDCVPAQEIPWLQSARYKRAPVKMLRTVIPIGKQKQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.87
3 0.87
4 0.82
5 0.78
6 0.75
7 0.73
8 0.65
9 0.56
10 0.48
11 0.39
12 0.37
13 0.31
14 0.21
15 0.14
16 0.12
17 0.12
18 0.11
19 0.11
20 0.09
21 0.09
22 0.1
23 0.08
24 0.08
25 0.07
26 0.07
27 0.06
28 0.05
29 0.05
30 0.06
31 0.06
32 0.06
33 0.06
34 0.06
35 0.06
36 0.12
37 0.15
38 0.14
39 0.17
40 0.23
41 0.28
42 0.32
43 0.34
44 0.31
45 0.32
46 0.36
47 0.36
48 0.32
49 0.3
50 0.32
51 0.3
52 0.28
53 0.23
54 0.18
55 0.16
56 0.16
57 0.15
58 0.12
59 0.12
60 0.12
61 0.11
62 0.12
63 0.11
64 0.09
65 0.07
66 0.03
67 0.04
68 0.04
69 0.04
70 0.04
71 0.04
72 0.04
73 0.04
74 0.05
75 0.05
76 0.05
77 0.05
78 0.05
79 0.05
80 0.06
81 0.07
82 0.06
83 0.08
84 0.08
85 0.08
86 0.08
87 0.08
88 0.07
89 0.07
90 0.06
91 0.05
92 0.05
93 0.05
94 0.05
95 0.05
96 0.04
97 0.04
98 0.04
99 0.04
100 0.03
101 0.04
102 0.06
103 0.06
104 0.07
105 0.08
106 0.08
107 0.08
108 0.13
109 0.14
110 0.14
111 0.16
112 0.16
113 0.17
114 0.19
115 0.19
116 0.16
117 0.18
118 0.19
119 0.19
120 0.2
121 0.2
122 0.18
123 0.19
124 0.16
125 0.14
126 0.12
127 0.11
128 0.09
129 0.07
130 0.07
131 0.05
132 0.05
133 0.05
134 0.04
135 0.03
136 0.03
137 0.04
138 0.04
139 0.04
140 0.05
141 0.08
142 0.1
143 0.11
144 0.15
145 0.23
146 0.25
147 0.31
148 0.34
149 0.35
150 0.37
151 0.43
152 0.39
153 0.39
154 0.4
155 0.38
156 0.35
157 0.39
158 0.34
159 0.3
160 0.35
161 0.29
162 0.25
163 0.28
164 0.32
165 0.33
166 0.4
167 0.45
168 0.46
169 0.54
170 0.62
171 0.64
172 0.69
173 0.69
174 0.66
175 0.62
176 0.6
177 0.55
178 0.51
179 0.5
180 0.5