Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A423VUU4

Protein Details
Accession A0A423VUU4    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
15-41LLWKIPWRLSKFQKRRQRNRLRAVDSVHydrophilic
77-103KYTIFDRKEKRYRKGIHKLPKWTRVSQHydrophilic
NLS Segment(s)
PositionSequence
84-96KEKRYRKGIHKLP
Subcellular Location(s) mito 21, mito_nucl 13, nucl 3, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFRFTNPLRSGLLWKIPWRLSKFQKRRQRNRLRAVDSVVDTLETALAKKGETVKALERWRAEMPREGEMLAKDKYTIFDRKEKRYRKGIHKLPKWTRVSQRLNPPGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.41
3 0.36
4 0.37
5 0.39
6 0.4
7 0.46
8 0.47
9 0.51
10 0.55
11 0.63
12 0.7
13 0.73
14 0.8
15 0.84
16 0.89
17 0.91
18 0.93
19 0.92
20 0.92
21 0.92
22 0.86
23 0.78
24 0.71
25 0.63
26 0.52
27 0.43
28 0.32
29 0.22
30 0.16
31 0.13
32 0.1
33 0.06
34 0.05
35 0.05
36 0.06
37 0.05
38 0.07
39 0.1
40 0.1
41 0.11
42 0.13
43 0.15
44 0.22
45 0.24
46 0.26
47 0.24
48 0.26
49 0.28
50 0.29
51 0.28
52 0.27
53 0.27
54 0.27
55 0.27
56 0.24
57 0.22
58 0.2
59 0.22
60 0.17
61 0.14
62 0.12
63 0.12
64 0.14
65 0.18
66 0.23
67 0.23
68 0.32
69 0.39
70 0.48
71 0.58
72 0.64
73 0.67
74 0.71
75 0.77
76 0.78
77 0.82
78 0.82
79 0.83
80 0.83
81 0.87
82 0.86
83 0.87
84 0.82
85 0.8
86 0.8
87 0.79
88 0.8
89 0.77
90 0.79