Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8JVJ0

Protein Details
Accession G8JVJ0   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
76-103EDPFAARKKQLRKMNREKIKQNNFLSRIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG erc:Ecym_6289  -  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MFSSPLIINKRLISTTLRLAEQKGSKAIISSCPAGTPLNLQIKKTGKEPVALHESEYPEWLWGVLDPQVEAAKLNEDPFAARKKQLRKMNREKIKQNNFLSRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.3
3 0.3
4 0.3
5 0.28
6 0.29
7 0.34
8 0.33
9 0.32
10 0.27
11 0.25
12 0.23
13 0.24
14 0.23
15 0.21
16 0.2
17 0.2
18 0.17
19 0.17
20 0.18
21 0.16
22 0.15
23 0.13
24 0.17
25 0.24
26 0.25
27 0.25
28 0.3
29 0.34
30 0.35
31 0.35
32 0.34
33 0.25
34 0.29
35 0.29
36 0.28
37 0.29
38 0.27
39 0.26
40 0.24
41 0.25
42 0.2
43 0.2
44 0.16
45 0.11
46 0.11
47 0.1
48 0.07
49 0.05
50 0.06
51 0.07
52 0.07
53 0.06
54 0.08
55 0.08
56 0.08
57 0.08
58 0.08
59 0.08
60 0.09
61 0.1
62 0.09
63 0.09
64 0.11
65 0.14
66 0.2
67 0.2
68 0.24
69 0.31
70 0.39
71 0.49
72 0.57
73 0.63
74 0.69
75 0.78
76 0.84
77 0.87
78 0.87
79 0.88
80 0.89
81 0.89
82 0.88
83 0.85