Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A423VT88

Protein Details
Accession A0A423VT88    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
239-264APGQAKSTWKKPDRGKPQGGSDRQRSHydrophilic
NLS Segment(s)
PositionSequence
246-274TWKKPDRGKPQGGSDRQRSSRPGGRPAPR
Subcellular Location(s) mito 27
Family & Domain DBs
Amino Acid Sequences MFRCFPRPGGIALRPLAPWLPPLSYGNSRGMTLSATTTTGGSHHHKAYEKGGLGSSQEDRKRLKDLSAHNIGMYTEQKTVSGLAWGHTTIKVARRHTVQRFDLDYFAGYGRPYGEAVFRRYLVDNAKPLWWSAKLVAGPTPVVRNKGSSRMNVAFREALREAGYDVQGWRVGEPVDGQQTKAQPWRRHIVQLYGSVEIAAHNLGELNNTKFSTLKARFAKVVKGLEEELGRTANGGSAAPGQAKSTWKKPDRGKPQGGSDRQRSSRPGGRPAPRMQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.33
3 0.3
4 0.22
5 0.21
6 0.17
7 0.17
8 0.18
9 0.2
10 0.25
11 0.28
12 0.31
13 0.34
14 0.33
15 0.31
16 0.29
17 0.27
18 0.22
19 0.18
20 0.17
21 0.12
22 0.12
23 0.12
24 0.11
25 0.11
26 0.11
27 0.15
28 0.18
29 0.22
30 0.23
31 0.27
32 0.3
33 0.33
34 0.36
35 0.39
36 0.35
37 0.31
38 0.3
39 0.26
40 0.24
41 0.25
42 0.24
43 0.25
44 0.26
45 0.29
46 0.31
47 0.33
48 0.37
49 0.36
50 0.37
51 0.36
52 0.4
53 0.44
54 0.49
55 0.46
56 0.41
57 0.4
58 0.35
59 0.31
60 0.25
61 0.19
62 0.14
63 0.13
64 0.13
65 0.13
66 0.14
67 0.11
68 0.13
69 0.11
70 0.1
71 0.11
72 0.11
73 0.12
74 0.11
75 0.13
76 0.12
77 0.19
78 0.24
79 0.25
80 0.29
81 0.33
82 0.42
83 0.47
84 0.53
85 0.48
86 0.47
87 0.49
88 0.46
89 0.41
90 0.33
91 0.26
92 0.19
93 0.16
94 0.12
95 0.08
96 0.07
97 0.07
98 0.07
99 0.07
100 0.07
101 0.11
102 0.13
103 0.16
104 0.18
105 0.18
106 0.18
107 0.19
108 0.21
109 0.2
110 0.21
111 0.2
112 0.19
113 0.2
114 0.19
115 0.18
116 0.18
117 0.15
118 0.13
119 0.11
120 0.13
121 0.12
122 0.13
123 0.14
124 0.12
125 0.12
126 0.11
127 0.15
128 0.13
129 0.15
130 0.15
131 0.17
132 0.18
133 0.26
134 0.28
135 0.25
136 0.3
137 0.32
138 0.35
139 0.32
140 0.33
141 0.27
142 0.24
143 0.28
144 0.22
145 0.18
146 0.15
147 0.15
148 0.13
149 0.12
150 0.13
151 0.09
152 0.09
153 0.09
154 0.1
155 0.1
156 0.09
157 0.09
158 0.08
159 0.08
160 0.09
161 0.1
162 0.15
163 0.16
164 0.16
165 0.18
166 0.2
167 0.23
168 0.29
169 0.35
170 0.33
171 0.38
172 0.45
173 0.45
174 0.5
175 0.49
176 0.49
177 0.44
178 0.45
179 0.42
180 0.35
181 0.33
182 0.26
183 0.24
184 0.17
185 0.13
186 0.07
187 0.05
188 0.04
189 0.05
190 0.05
191 0.07
192 0.09
193 0.11
194 0.14
195 0.14
196 0.15
197 0.15
198 0.16
199 0.24
200 0.25
201 0.32
202 0.34
203 0.37
204 0.42
205 0.43
206 0.48
207 0.44
208 0.45
209 0.37
210 0.36
211 0.34
212 0.32
213 0.3
214 0.25
215 0.21
216 0.17
217 0.15
218 0.12
219 0.11
220 0.1
221 0.1
222 0.09
223 0.08
224 0.1
225 0.11
226 0.13
227 0.13
228 0.13
229 0.16
230 0.22
231 0.26
232 0.32
233 0.41
234 0.46
235 0.55
236 0.63
237 0.71
238 0.76
239 0.81
240 0.82
241 0.78
242 0.83
243 0.84
244 0.83
245 0.81
246 0.79
247 0.78
248 0.73
249 0.71
250 0.65
251 0.63
252 0.63
253 0.61
254 0.62
255 0.62
256 0.66