Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A423VNX7

Protein Details
Accession A0A423VNX7    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
21-40SSARIKKNKKSSLIKFKVRCHydrophilic
NLS Segment(s)
PositionSequence
23-31ARIKKNKKS
74-79REKKIK
Subcellular Location(s) nucl 22, cyto_nucl 14.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MAQEVSDIKKFIEICRRKDASSARIKKNKKSSLIKFKVRCSKHLYTLALKDAEKAEKLKQSLPPNLQIKEVTKREKKIKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.49
3 0.52
4 0.48
5 0.54
6 0.55
7 0.53
8 0.57
9 0.6
10 0.6
11 0.67
12 0.71
13 0.73
14 0.77
15 0.75
16 0.73
17 0.73
18 0.73
19 0.76
20 0.8
21 0.8
22 0.74
23 0.75
24 0.75
25 0.67
26 0.61
27 0.58
28 0.53
29 0.51
30 0.52
31 0.47
32 0.42
33 0.42
34 0.41
35 0.35
36 0.31
37 0.26
38 0.23
39 0.21
40 0.19
41 0.19
42 0.2
43 0.23
44 0.25
45 0.28
46 0.33
47 0.39
48 0.45
49 0.47
50 0.52
51 0.53
52 0.52
53 0.51
54 0.47
55 0.44
56 0.46
57 0.5
58 0.51
59 0.53
60 0.6