Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A423WJ79

Protein Details
Accession A0A423WJ79    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
68-90AASSDRMRSKKKRNNRKGSIFMAHydrophilic
NLS Segment(s)
PositionSequence
75-84RSKKKRNNRK
Subcellular Location(s) nucl 14, mito_nucl 13.333, mito 11.5, cyto_nucl 8.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR001842  Peptidase_M36  
Gene Ontology GO:0005615  C:extracellular space  
GO:0004222  F:metalloendopeptidase activity  
GO:0008270  F:zinc ion binding  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF02128  Peptidase_M36  
Amino Acid Sequences MFFKNLSSTRNMRISRKIKNAHFVPSLDGERGILILGLNDITDPRRDQAFEAQIIIHQYTHGMTYRLAASSDRMRSKKKRNNRKGSIFMALAISEKDIQNRSFTFNEWQDPETRSLPYSTHSLENDYAFSSLRNITYWEAHYIVEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.64
3 0.69
4 0.71
5 0.68
6 0.73
7 0.7
8 0.67
9 0.63
10 0.54
11 0.47
12 0.43
13 0.4
14 0.31
15 0.27
16 0.2
17 0.17
18 0.16
19 0.12
20 0.07
21 0.05
22 0.04
23 0.05
24 0.04
25 0.04
26 0.04
27 0.05
28 0.06
29 0.08
30 0.09
31 0.1
32 0.12
33 0.12
34 0.14
35 0.21
36 0.23
37 0.22
38 0.22
39 0.2
40 0.19
41 0.2
42 0.19
43 0.12
44 0.08
45 0.07
46 0.07
47 0.08
48 0.08
49 0.07
50 0.07
51 0.08
52 0.09
53 0.09
54 0.1
55 0.09
56 0.1
57 0.14
58 0.19
59 0.23
60 0.25
61 0.31
62 0.39
63 0.5
64 0.56
65 0.62
66 0.69
67 0.75
68 0.83
69 0.86
70 0.87
71 0.82
72 0.77
73 0.71
74 0.59
75 0.49
76 0.38
77 0.29
78 0.2
79 0.14
80 0.11
81 0.08
82 0.08
83 0.1
84 0.13
85 0.13
86 0.16
87 0.17
88 0.21
89 0.2
90 0.22
91 0.26
92 0.26
93 0.29
94 0.29
95 0.29
96 0.27
97 0.29
98 0.31
99 0.26
100 0.25
101 0.21
102 0.2
103 0.2
104 0.19
105 0.21
106 0.19
107 0.23
108 0.22
109 0.25
110 0.26
111 0.26
112 0.25
113 0.22
114 0.2
115 0.15
116 0.15
117 0.14
118 0.14
119 0.13
120 0.13
121 0.15
122 0.17
123 0.21
124 0.23
125 0.24
126 0.23