Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A423VA85

Protein Details
Accession A0A423VA85    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
57-78AVDVPRKHGHRRRHDRSSGSVRBasic
NLS Segment(s)
PositionSequence
65-69GHRRR
Subcellular Location(s) nucl 14, cyto_nucl 11.833, cyto 7.5, cyto_mito 6.666, mito 4.5
Family & Domain DBs
Amino Acid Sequences MSYYCANYYTFINCHHIVTRFGDRCDLCLLLKSGASLTNGILPEESSHNNSHDHMHAVDVPRKHGHRRRHDRSSGSVRVDSRYEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.28
3 0.28
4 0.27
5 0.3
6 0.37
7 0.34
8 0.34
9 0.38
10 0.34
11 0.34
12 0.33
13 0.29
14 0.2
15 0.19
16 0.2
17 0.14
18 0.14
19 0.13
20 0.11
21 0.11
22 0.12
23 0.09
24 0.08
25 0.11
26 0.11
27 0.1
28 0.1
29 0.08
30 0.09
31 0.1
32 0.11
33 0.11
34 0.12
35 0.13
36 0.14
37 0.15
38 0.16
39 0.15
40 0.16
41 0.13
42 0.14
43 0.16
44 0.18
45 0.22
46 0.21
47 0.23
48 0.27
49 0.3
50 0.39
51 0.44
52 0.51
53 0.58
54 0.68
55 0.74
56 0.79
57 0.84
58 0.79
59 0.81
60 0.8
61 0.76
62 0.7
63 0.66
64 0.57
65 0.53