Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8JN58

Protein Details
Accession G8JN58    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
66-92VLAVPKKKVSHQKKRQRQYAPGKKQLQHydrophilic
NLS Segment(s)
PositionSequence
71-82KKKVSHQKKRQR
Subcellular Location(s) nucl 16, mito 6, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG erc:Ecym_1283  -  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences MALNFSINSCGRLLFERATQVFPRLEIGGGSGASNVMIPRTLLEMLQRRFGNANNEEGYQSDNGIVLAVPKKKVSHQKKRQRQYAPGKKQLQMMHHLNKCPSCGHYKRQNTLCMYCFNEIRHIWKTYTNKPLEEPLQEQELSDLDKRLLYPGKNETEYLERLRDKDSYLEKRVRTLPVEEKKTKGGSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.2
3 0.26
4 0.28
5 0.31
6 0.31
7 0.32
8 0.29
9 0.27
10 0.27
11 0.21
12 0.19
13 0.15
14 0.15
15 0.12
16 0.12
17 0.11
18 0.09
19 0.08
20 0.07
21 0.08
22 0.06
23 0.05
24 0.05
25 0.05
26 0.06
27 0.08
28 0.09
29 0.09
30 0.15
31 0.23
32 0.24
33 0.31
34 0.3
35 0.29
36 0.3
37 0.33
38 0.35
39 0.28
40 0.32
41 0.27
42 0.27
43 0.26
44 0.25
45 0.24
46 0.16
47 0.14
48 0.09
49 0.08
50 0.07
51 0.07
52 0.06
53 0.07
54 0.11
55 0.13
56 0.14
57 0.15
58 0.16
59 0.22
60 0.33
61 0.41
62 0.48
63 0.57
64 0.67
65 0.76
66 0.85
67 0.88
68 0.84
69 0.83
70 0.83
71 0.84
72 0.82
73 0.82
74 0.76
75 0.7
76 0.68
77 0.62
78 0.53
79 0.49
80 0.46
81 0.44
82 0.42
83 0.42
84 0.38
85 0.35
86 0.34
87 0.28
88 0.23
89 0.24
90 0.25
91 0.32
92 0.4
93 0.46
94 0.52
95 0.56
96 0.6
97 0.55
98 0.55
99 0.49
100 0.43
101 0.39
102 0.34
103 0.31
104 0.26
105 0.27
106 0.24
107 0.27
108 0.27
109 0.26
110 0.25
111 0.31
112 0.36
113 0.38
114 0.47
115 0.44
116 0.42
117 0.41
118 0.45
119 0.41
120 0.39
121 0.34
122 0.27
123 0.28
124 0.27
125 0.25
126 0.2
127 0.18
128 0.17
129 0.15
130 0.14
131 0.11
132 0.12
133 0.12
134 0.16
135 0.2
136 0.19
137 0.23
138 0.29
139 0.35
140 0.35
141 0.36
142 0.34
143 0.34
144 0.37
145 0.35
146 0.35
147 0.31
148 0.31
149 0.33
150 0.32
151 0.28
152 0.33
153 0.39
154 0.4
155 0.46
156 0.52
157 0.5
158 0.55
159 0.58
160 0.56
161 0.49
162 0.48
163 0.5
164 0.53
165 0.62
166 0.6
167 0.59
168 0.59