Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A423W5C5

Protein Details
Accession A0A423W5C5    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
368-391GDGPVPGARRRRRQQHGQEQGQGQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10mito 10mito_nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR012336  Thioredoxin-like_fold  
Pfam View protein in Pfam  
PF17172  GST_N_4  
CDD cd03054  GST_N_Metaxin  
Amino Acid Sequences MTHAQATARGSWYSTIPAPLQRLFDAVPLVTYPPNELPYRSPGPTDLPTLHVFISDQDAARGSPSYNPSCLKWQAFLRIAGVRFHLRPSTNHASPTGALPFLQPPIPSISSTSTTTTNPTTTTKTNNPDATPATGRNHQRLSPRNHLLPVPSSRLEAYAAQHGALPPKPSQSHSQSKSQSQAQSQARRRQAYQSLLDGPVRDAWLYSLYLSPANEHVLRRWYVDPVSRSGAVRDTVLRQLRRAVRAEMAKSSSSSSSSSCSAAATGLGTTGGFGWWSLSGSMGDVLAWAAGGAAAVDPSKVYAEAARALEALDTLLCPVGEEEEGPPSEAGGDGAGAGAGQRWFFGEPHPTVFDAAVFSYVYLILHGGDGPVPGARRRRRQQHGQEQGQGQGQGQGQGQGQGQEQEQKQQQPWADDTLRQILLGRCGRLVGHTQRILDEYWTDQAEQGWVEISP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.23
4 0.27
5 0.31
6 0.32
7 0.34
8 0.3
9 0.31
10 0.28
11 0.27
12 0.24
13 0.19
14 0.17
15 0.15
16 0.17
17 0.16
18 0.15
19 0.17
20 0.18
21 0.22
22 0.23
23 0.24
24 0.26
25 0.32
26 0.37
27 0.34
28 0.33
29 0.31
30 0.35
31 0.36
32 0.37
33 0.31
34 0.29
35 0.3
36 0.3
37 0.27
38 0.22
39 0.2
40 0.16
41 0.2
42 0.18
43 0.16
44 0.15
45 0.16
46 0.16
47 0.17
48 0.17
49 0.12
50 0.15
51 0.22
52 0.24
53 0.28
54 0.3
55 0.31
56 0.37
57 0.43
58 0.39
59 0.38
60 0.38
61 0.43
62 0.44
63 0.42
64 0.39
65 0.38
66 0.37
67 0.33
68 0.33
69 0.29
70 0.26
71 0.28
72 0.29
73 0.26
74 0.27
75 0.35
76 0.4
77 0.38
78 0.39
79 0.37
80 0.35
81 0.33
82 0.34
83 0.27
84 0.18
85 0.16
86 0.16
87 0.16
88 0.15
89 0.17
90 0.13
91 0.13
92 0.18
93 0.2
94 0.19
95 0.19
96 0.21
97 0.22
98 0.24
99 0.25
100 0.21
101 0.21
102 0.23
103 0.23
104 0.2
105 0.2
106 0.2
107 0.23
108 0.23
109 0.29
110 0.33
111 0.37
112 0.43
113 0.44
114 0.42
115 0.41
116 0.41
117 0.38
118 0.34
119 0.33
120 0.29
121 0.33
122 0.35
123 0.37
124 0.38
125 0.38
126 0.43
127 0.48
128 0.53
129 0.56
130 0.58
131 0.55
132 0.54
133 0.52
134 0.46
135 0.43
136 0.39
137 0.34
138 0.29
139 0.27
140 0.25
141 0.24
142 0.23
143 0.2
144 0.17
145 0.17
146 0.16
147 0.15
148 0.16
149 0.16
150 0.17
151 0.17
152 0.18
153 0.14
154 0.19
155 0.2
156 0.22
157 0.28
158 0.32
159 0.41
160 0.41
161 0.49
162 0.48
163 0.5
164 0.53
165 0.51
166 0.48
167 0.4
168 0.45
169 0.44
170 0.5
171 0.55
172 0.58
173 0.59
174 0.58
175 0.57
176 0.55
177 0.54
178 0.5
179 0.44
180 0.39
181 0.35
182 0.35
183 0.34
184 0.27
185 0.22
186 0.17
187 0.15
188 0.11
189 0.08
190 0.07
191 0.08
192 0.08
193 0.08
194 0.07
195 0.07
196 0.09
197 0.09
198 0.09
199 0.08
200 0.11
201 0.12
202 0.12
203 0.13
204 0.16
205 0.16
206 0.18
207 0.18
208 0.17
209 0.17
210 0.21
211 0.21
212 0.2
213 0.22
214 0.2
215 0.19
216 0.18
217 0.18
218 0.15
219 0.14
220 0.12
221 0.12
222 0.17
223 0.22
224 0.22
225 0.21
226 0.27
227 0.3
228 0.33
229 0.33
230 0.29
231 0.28
232 0.32
233 0.32
234 0.28
235 0.27
236 0.23
237 0.21
238 0.21
239 0.17
240 0.15
241 0.14
242 0.12
243 0.12
244 0.13
245 0.13
246 0.12
247 0.11
248 0.1
249 0.09
250 0.08
251 0.06
252 0.05
253 0.04
254 0.04
255 0.04
256 0.04
257 0.04
258 0.03
259 0.03
260 0.03
261 0.04
262 0.04
263 0.05
264 0.04
265 0.05
266 0.05
267 0.06
268 0.06
269 0.05
270 0.05
271 0.04
272 0.04
273 0.03
274 0.03
275 0.03
276 0.02
277 0.02
278 0.02
279 0.02
280 0.02
281 0.03
282 0.03
283 0.03
284 0.03
285 0.03
286 0.04
287 0.04
288 0.05
289 0.06
290 0.07
291 0.11
292 0.12
293 0.12
294 0.11
295 0.11
296 0.11
297 0.1
298 0.08
299 0.05
300 0.04
301 0.04
302 0.05
303 0.04
304 0.04
305 0.04
306 0.05
307 0.05
308 0.06
309 0.07
310 0.1
311 0.1
312 0.11
313 0.11
314 0.09
315 0.09
316 0.09
317 0.08
318 0.05
319 0.04
320 0.03
321 0.03
322 0.03
323 0.03
324 0.03
325 0.04
326 0.05
327 0.05
328 0.05
329 0.06
330 0.08
331 0.08
332 0.12
333 0.17
334 0.18
335 0.22
336 0.24
337 0.23
338 0.22
339 0.22
340 0.2
341 0.14
342 0.13
343 0.1
344 0.08
345 0.08
346 0.07
347 0.07
348 0.07
349 0.06
350 0.06
351 0.05
352 0.05
353 0.05
354 0.05
355 0.06
356 0.06
357 0.06
358 0.08
359 0.09
360 0.13
361 0.23
362 0.31
363 0.41
364 0.51
365 0.61
366 0.69
367 0.78
368 0.85
369 0.87
370 0.89
371 0.86
372 0.84
373 0.76
374 0.7
375 0.62
376 0.51
377 0.4
378 0.35
379 0.28
380 0.23
381 0.22
382 0.21
383 0.18
384 0.21
385 0.21
386 0.18
387 0.19
388 0.18
389 0.19
390 0.24
391 0.24
392 0.29
393 0.34
394 0.38
395 0.39
396 0.43
397 0.45
398 0.42
399 0.44
400 0.44
401 0.41
402 0.38
403 0.4
404 0.4
405 0.37
406 0.32
407 0.33
408 0.28
409 0.34
410 0.36
411 0.33
412 0.26
413 0.27
414 0.27
415 0.26
416 0.33
417 0.31
418 0.36
419 0.38
420 0.39
421 0.4
422 0.42
423 0.4
424 0.33
425 0.28
426 0.21
427 0.22
428 0.23
429 0.22
430 0.21
431 0.2
432 0.2
433 0.18
434 0.15