FuNGI

A0A423W5C5

Protein Details

Accession

A0A423W5C5

Localization Confidence

Low

Confidence Score

8.3

NoLS Segment(s)

Position	Sequence	Protein Nature
368-391	GDGPVPGARRRRRQQHGQEQGQGQ	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 10, mito 10, mito_nucl 10

Family & Domain DBs

InterPro	View protein in InterPro IPR012336 Thioredoxin-like_fold
Pfam	View protein in Pfam PF17172 GST_N_4
CDD	cd03054 GST_N_Metaxin

Amino Acid Sequences

MTHAQATARGSWYSTIPAPLQRLFDAVPLVTYPPNELPYRSPGPTDLPTLHVFISDQDAARGSPSYNPSCLKWQAFLRIAGVRFHLRPSTNHASPTGALPFLQPPIPSISSTSTTTTNPTTTTKTNNPDATPATGRNHQRLSPRNHLLPVPSSRLEAYAAQHGALPPKPSQSHSQSKSQSQAQSQARRRQAYQSLLDGPVRDAWLYSLYLSPANEHVLRRWYVDPVSRSGAVRDTVLRQLRRAVRAEMAKSSSSSSSSSCSAAATGLGTTGGFGWWSLSGSMGDVLAWAAGGAAAVDPSKVYAEAARALEALDTLLCPVGEEEEGPPSEAGGDGAGAGAGQRWFFGEPHPTVFDAAVFSYVYLILHGGDGPVPGARRRRRQQHGQEQGQGQGQGQGQGQGQGQEQEQKQQQPWADDTLRQILLGRCGRLVGHTQRILDEYWTDQAEQGWVEISP

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.22
2	0.22
3	0.23
4	0.27
5	0.31
6	0.32
7	0.34
8	0.3
9	0.31
10	0.28
11	0.27
12	0.24
13	0.19
14	0.17
15	0.15
16	0.17
17	0.16
18	0.15
19	0.17
20	0.18
21	0.22
22	0.23
23	0.24
24	0.26
25	0.32
26	0.37
27	0.34
28	0.33
29	0.31
30	0.35
31	0.36
32	0.37
33	0.31
34	0.29
35	0.3
36	0.3
37	0.27
38	0.22
39	0.2
40	0.16
41	0.2
42	0.18
43	0.16
44	0.15
45	0.16
46	0.16
47	0.17
48	0.17
49	0.12
50	0.15
51	0.22
52	0.24
53	0.28
54	0.3
55	0.31
56	0.37
57	0.43
58	0.39
59	0.38
60	0.38
61	0.43
62	0.44
63	0.42
64	0.39
65	0.38
66	0.37
67	0.33
68	0.33
69	0.29
70	0.26
71	0.28
72	0.29
73	0.26
74	0.27
75	0.35
76	0.4
77	0.38
78	0.39
79	0.37
80	0.35
81	0.33
82	0.34
83	0.27
84	0.18
85	0.16
86	0.16
87	0.16
88	0.15
89	0.17
90	0.13
91	0.13
92	0.18
93	0.2
94	0.19
95	0.19
96	0.21
97	0.22
98	0.24
99	0.25
100	0.21
101	0.21
102	0.23
103	0.23
104	0.2
105	0.2
106	0.2
107	0.23
108	0.23
109	0.29
110	0.33
111	0.37
112	0.43
113	0.44
114	0.42
115	0.41
116	0.41
117	0.38
118	0.34
119	0.33
120	0.29
121	0.33
122	0.35
123	0.37
124	0.38
125	0.38
126	0.43
127	0.48
128	0.53
129	0.56
130	0.58
131	0.55
132	0.54
133	0.52
134	0.46
135	0.43
136	0.39
137	0.34
138	0.29
139	0.27
140	0.25
141	0.24
142	0.23
143	0.2
144	0.17
145	0.17
146	0.16
147	0.15
148	0.16
149	0.16
150	0.17
151	0.17
152	0.18
153	0.14
154	0.19
155	0.2
156	0.22
157	0.28
158	0.32
159	0.41
160	0.41
161	0.49
162	0.48
163	0.5
164	0.53
165	0.51
166	0.48
167	0.4
168	0.45
169	0.44
170	0.5
171	0.55
172	0.58
173	0.59
174	0.58
175	0.57
176	0.55
177	0.54
178	0.5
179	0.44
180	0.39
181	0.35
182	0.35
183	0.34
184	0.27
185	0.22
186	0.17
187	0.15
188	0.11
189	0.08
190	0.07
191	0.08
192	0.08
193	0.08
194	0.07
195	0.07
196	0.09
197	0.09
198	0.09
199	0.08
200	0.11
201	0.12
202	0.12
203	0.13
204	0.16
205	0.16
206	0.18
207	0.18
208	0.17
209	0.17
210	0.21
211	0.21
212	0.2
213	0.22
214	0.2
215	0.19
216	0.18
217	0.18
218	0.15
219	0.14
220	0.12
221	0.12
222	0.17
223	0.22
224	0.22
225	0.21
226	0.27
227	0.3
228	0.33
229	0.33
230	0.29
231	0.28
232	0.32
233	0.32
234	0.28
235	0.27
236	0.23
237	0.21
238	0.21
239	0.17
240	0.15
241	0.14
242	0.12
243	0.12
244	0.13
245	0.13
246	0.12
247	0.11
248	0.1
249	0.09
250	0.08
251	0.06
252	0.05
253	0.04
254	0.04
255	0.04
256	0.04
257	0.04
258	0.03
259	0.03
260	0.03
261	0.04
262	0.04
263	0.05
264	0.04
265	0.05
266	0.05
267	0.06
268	0.06
269	0.05
270	0.05
271	0.04
272	0.04
273	0.03
274	0.03
275	0.03
276	0.02
277	0.02
278	0.02
279	0.02
280	0.02
281	0.03
282	0.03
283	0.03
284	0.03
285	0.03
286	0.04
287	0.04
288	0.05
289	0.06
290	0.07
291	0.11
292	0.12
293	0.12
294	0.11
295	0.11
296	0.11
297	0.1
298	0.08
299	0.05
300	0.04
301	0.04
302	0.05
303	0.04
304	0.04
305	0.04
306	0.05
307	0.05
308	0.06
309	0.07
310	0.1
311	0.1
312	0.11
313	0.11
314	0.09
315	0.09
316	0.09
317	0.08
318	0.05
319	0.04
320	0.03
321	0.03
322	0.03
323	0.03
324	0.03
325	0.04
326	0.05
327	0.05
328	0.05
329	0.06
330	0.08
331	0.08
332	0.12
333	0.17
334	0.18
335	0.22
336	0.24
337	0.23
338	0.22
339	0.22
340	0.2
341	0.14
342	0.13
343	0.1
344	0.08
345	0.08
346	0.07
347	0.07
348	0.07
349	0.06
350	0.06
351	0.05
352	0.05
353	0.05
354	0.05
355	0.06
356	0.06
357	0.06
358	0.08
359	0.09
360	0.13
361	0.23
362	0.31
363	0.41
364	0.51
365	0.61
366	0.69
367	0.78
368	0.85
369	0.87
370	0.89
371	0.86
372	0.84
373	0.76
374	0.7
375	0.62
376	0.51
377	0.4
378	0.35
379	0.28
380	0.23
381	0.22
382	0.21
383	0.18
384	0.21
385	0.21
386	0.18
387	0.19
388	0.18
389	0.19
390	0.24
391	0.24
392	0.29
393	0.34
394	0.38
395	0.39
396	0.43
397	0.45
398	0.42
399	0.44
400	0.44
401	0.41
402	0.38
403	0.4
404	0.4
405	0.37
406	0.32
407	0.33
408	0.28
409	0.34
410	0.36
411	0.33
412	0.26
413	0.27
414	0.27
415	0.26
416	0.33
417	0.31
418	0.36
419	0.38
420	0.39
421	0.4
422	0.42
423	0.4
424	0.33
425	0.28
426	0.21
427	0.22
428	0.23
429	0.22
430	0.21
431	0.2
432	0.2
433	0.18
434	0.15

A0A423W5C5

3D AlphaFold-predicted Structure Viewer