Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2L3W7

Protein Details
Accession E2L3W7    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
139-161DLVDKWKKDGKPHRRPPGLREVPBasic
NLS Segment(s)
PositionSequence
145-157KKDGKPHRRPPGL
Subcellular Location(s) mito 8, cyto 7.5, nucl 6, cyto_pero 5.5, pero 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012341  6hp_glycosidase-like_sf  
IPR001382  Glyco_hydro_47  
IPR036026  Seven-hairpin_glycosidases  
Gene Ontology GO:0016020  C:membrane  
GO:0005509  F:calcium ion binding  
GO:0004571  F:mannosyl-oligosaccharide 1,2-alpha-mannosidase activity  
GO:0005975  P:carbohydrate metabolic process  
GO:0030433  P:ubiquitin-dependent ERAD pathway  
KEGG mpr:MPER_00320  -  
Pfam View protein in Pfam  
PF01532  Glyco_hydro_47  
Amino Acid Sequences QWLLTGRSETKIRDLYFQATHAIIHNLLYLPPDRDFLYVTDTHFAPSNKSHPHVPSHNFEHLSCFLPGLLALGTVTLKESDFPSADERELHLWAAEGLAYACWLSYADQKTGLGPDEMNVNSWPQTDLETTSPQGRWVDLVDKWKKDGKPHRRPPGLREVPPENMSGKRGYINRKSAYLLRPE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.39
3 0.38
4 0.37
5 0.32
6 0.26
7 0.25
8 0.22
9 0.21
10 0.15
11 0.14
12 0.14
13 0.12
14 0.12
15 0.13
16 0.13
17 0.14
18 0.14
19 0.16
20 0.15
21 0.16
22 0.17
23 0.16
24 0.19
25 0.18
26 0.18
27 0.19
28 0.18
29 0.18
30 0.21
31 0.2
32 0.18
33 0.2
34 0.26
35 0.27
36 0.29
37 0.33
38 0.32
39 0.38
40 0.43
41 0.44
42 0.44
43 0.45
44 0.48
45 0.45
46 0.43
47 0.41
48 0.35
49 0.33
50 0.26
51 0.2
52 0.15
53 0.13
54 0.13
55 0.09
56 0.07
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.04
65 0.05
66 0.06
67 0.07
68 0.08
69 0.09
70 0.11
71 0.12
72 0.12
73 0.12
74 0.13
75 0.13
76 0.13
77 0.11
78 0.08
79 0.07
80 0.07
81 0.06
82 0.05
83 0.03
84 0.03
85 0.03
86 0.03
87 0.03
88 0.03
89 0.03
90 0.03
91 0.04
92 0.09
93 0.12
94 0.12
95 0.13
96 0.14
97 0.14
98 0.15
99 0.15
100 0.1
101 0.08
102 0.08
103 0.11
104 0.11
105 0.12
106 0.11
107 0.11
108 0.11
109 0.12
110 0.12
111 0.08
112 0.1
113 0.1
114 0.12
115 0.14
116 0.16
117 0.17
118 0.19
119 0.19
120 0.2
121 0.2
122 0.17
123 0.15
124 0.15
125 0.18
126 0.17
127 0.27
128 0.31
129 0.32
130 0.35
131 0.41
132 0.41
133 0.48
134 0.56
135 0.57
136 0.62
137 0.72
138 0.8
139 0.83
140 0.84
141 0.81
142 0.82
143 0.8
144 0.73
145 0.7
146 0.64
147 0.6
148 0.58
149 0.53
150 0.44
151 0.37
152 0.35
153 0.3
154 0.26
155 0.26
156 0.3
157 0.37
158 0.44
159 0.5
160 0.51
161 0.52
162 0.55
163 0.56