Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A423VI66

Protein Details
Accession A0A423VI66    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
4-23ENKRTLTKTRRYRRDIDQIKHydrophilic
64-89TLAAHQRGKPHKRRVKQLKEEPYTQKHydrophilic
NLS Segment(s)
PositionSequence
71-78GKPHKRRV
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003604  Matrin/U1-like-C_Znf_C2H2  
IPR022755  Znf_C2H2_jaz  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF12171  zf-C2H2_jaz  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MGVENKRTLTKTRRYRRDIDQIKADLTSPKHLKQYKDSKLPEDLPDLGRNYCVQCAKWFEAASTLAAHQRGKPHKRRVKQLKEEPYTQKTAEAAVGLWTDNKGPAKAQTGDVDMSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.78
3 0.8
4 0.82
5 0.8
6 0.76
7 0.73
8 0.65
9 0.59
10 0.53
11 0.44
12 0.38
13 0.32
14 0.34
15 0.29
16 0.31
17 0.38
18 0.42
19 0.44
20 0.49
21 0.58
22 0.57
23 0.63
24 0.62
25 0.57
26 0.59
27 0.58
28 0.5
29 0.43
30 0.36
31 0.29
32 0.29
33 0.27
34 0.22
35 0.2
36 0.18
37 0.16
38 0.17
39 0.16
40 0.13
41 0.15
42 0.19
43 0.21
44 0.22
45 0.21
46 0.18
47 0.19
48 0.19
49 0.17
50 0.12
51 0.11
52 0.1
53 0.11
54 0.12
55 0.12
56 0.19
57 0.28
58 0.37
59 0.46
60 0.55
61 0.63
62 0.69
63 0.79
64 0.82
65 0.84
66 0.86
67 0.87
68 0.86
69 0.82
70 0.82
71 0.79
72 0.72
73 0.65
74 0.55
75 0.46
76 0.36
77 0.32
78 0.25
79 0.18
80 0.13
81 0.11
82 0.11
83 0.1
84 0.1
85 0.09
86 0.09
87 0.13
88 0.15
89 0.14
90 0.16
91 0.2
92 0.25
93 0.27
94 0.3
95 0.29
96 0.3