Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A423WFF8

Protein Details
Accession A0A423WFF8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
81-111AGNSWMRQRRAVRKRSIRRHWTPRTRTWNEDHydrophilic
NLS Segment(s)
PositionSequence
89-99RRAVRKRSIRR
Subcellular Location(s) plas 13, extr 9, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR021278  ATP19  
Gene Ontology GO:0016020  C:membrane  
GO:0005739  C:mitochondrion  
Pfam View protein in Pfam  
PF11022  ATP19  
Amino Acid Sequences MVQYYNLFGAKVGSHYLAMGVLAALFGGTSMAIGGGSKKATQTPPLNAASPDEADFIKYIHPGPALVTESRNIWVNADIMAGNSWMRQRRAVRKRSIRRHWTPRTRTWNEDHEEVITPGSTVQI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.12
4 0.1
5 0.09
6 0.07
7 0.05
8 0.04
9 0.04
10 0.03
11 0.03
12 0.02
13 0.02
14 0.02
15 0.02
16 0.02
17 0.02
18 0.02
19 0.02
20 0.03
21 0.04
22 0.05
23 0.06
24 0.07
25 0.08
26 0.11
27 0.13
28 0.2
29 0.23
30 0.25
31 0.3
32 0.32
33 0.32
34 0.29
35 0.29
36 0.23
37 0.2
38 0.17
39 0.12
40 0.1
41 0.1
42 0.1
43 0.08
44 0.08
45 0.08
46 0.07
47 0.07
48 0.08
49 0.07
50 0.07
51 0.1
52 0.11
53 0.11
54 0.11
55 0.1
56 0.11
57 0.12
58 0.13
59 0.11
60 0.1
61 0.1
62 0.1
63 0.09
64 0.09
65 0.08
66 0.07
67 0.07
68 0.07
69 0.06
70 0.07
71 0.1
72 0.14
73 0.15
74 0.22
75 0.29
76 0.4
77 0.5
78 0.57
79 0.64
80 0.71
81 0.81
82 0.86
83 0.89
84 0.88
85 0.89
86 0.91
87 0.91
88 0.91
89 0.88
90 0.88
91 0.88
92 0.84
93 0.79
94 0.75
95 0.72
96 0.66
97 0.61
98 0.52
99 0.44
100 0.4
101 0.34
102 0.29
103 0.2
104 0.15