Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A423VKE7

Protein Details
Accession A0A423VKE7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MGKRKKSSRKPMGKKRNDPLPTVBasic
NLS Segment(s)
PositionSequence
3-16KRKKSSRKPMGKKR
Subcellular Location(s) mito 12cyto 12cyto_mito 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKKSSRKPMGKKRNDPLPTVFTCLFCNHENSVTVKIDKKGGVGSLECKVCGQRFQCTINYLSAAVDVYGEWVDAAEAVAKGEGDTATEQHLGEPSRGATRKDRRTANDSDGEPEYSGEGIVADDDDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.92
3 0.91
4 0.83
5 0.77
6 0.71
7 0.67
8 0.58
9 0.54
10 0.47
11 0.37
12 0.36
13 0.33
14 0.3
15 0.24
16 0.25
17 0.21
18 0.22
19 0.22
20 0.22
21 0.25
22 0.24
23 0.25
24 0.24
25 0.24
26 0.25
27 0.24
28 0.22
29 0.19
30 0.18
31 0.17
32 0.15
33 0.16
34 0.17
35 0.17
36 0.16
37 0.16
38 0.16
39 0.15
40 0.19
41 0.18
42 0.19
43 0.22
44 0.25
45 0.26
46 0.27
47 0.27
48 0.23
49 0.22
50 0.17
51 0.13
52 0.11
53 0.09
54 0.06
55 0.05
56 0.04
57 0.04
58 0.04
59 0.04
60 0.03
61 0.03
62 0.03
63 0.03
64 0.03
65 0.03
66 0.03
67 0.04
68 0.04
69 0.04
70 0.04
71 0.05
72 0.04
73 0.05
74 0.05
75 0.06
76 0.08
77 0.09
78 0.09
79 0.09
80 0.12
81 0.12
82 0.12
83 0.12
84 0.12
85 0.18
86 0.21
87 0.23
88 0.31
89 0.4
90 0.49
91 0.56
92 0.62
93 0.61
94 0.64
95 0.68
96 0.65
97 0.62
98 0.53
99 0.5
100 0.45
101 0.4
102 0.34
103 0.28
104 0.22
105 0.15
106 0.14
107 0.1
108 0.07
109 0.06
110 0.06