Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A423VG07

Protein Details
Accession A0A423VG07    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
181-203QDVEIQVRRARKKRAKAEAAAAKHydrophilic
NLS Segment(s)
PositionSequence
188-199RRARKKRAKAEA
Subcellular Location(s) nucl 14, cyto_nucl 12.833, mito_nucl 9.499, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR040357  Vma22/CCDC115  
Gene Ontology GO:0070072  P:vacuolar proton-transporting V-type ATPase complex assembly  
Amino Acid Sequences MDTETDTIDTLLERYLSLLDEYTTLRTELGRLQTSMFQHLARANFSAERGMRYGPDSYDERMQATRRVKTSLRGEVPVFRVTTCDELSSGATETPPSGLVSDPPVGAAAETETGRPDEAVSAEEEDKVREKGDEAKRQRLKDPLRWFGVLTPLALRQTQGCAIEAVDQVIPKLLSVDAAMQDVEIQVRRARKKRAKAEAAAAKEHASGQHQGKVVREEVAAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.09
4 0.1
5 0.1
6 0.09
7 0.1
8 0.12
9 0.13
10 0.13
11 0.12
12 0.12
13 0.12
14 0.13
15 0.17
16 0.22
17 0.22
18 0.22
19 0.23
20 0.27
21 0.29
22 0.31
23 0.28
24 0.22
25 0.22
26 0.25
27 0.25
28 0.22
29 0.22
30 0.19
31 0.18
32 0.19
33 0.22
34 0.19
35 0.19
36 0.19
37 0.19
38 0.18
39 0.19
40 0.2
41 0.15
42 0.18
43 0.19
44 0.2
45 0.23
46 0.23
47 0.22
48 0.24
49 0.25
50 0.28
51 0.32
52 0.34
53 0.32
54 0.36
55 0.35
56 0.4
57 0.45
58 0.47
59 0.43
60 0.41
61 0.41
62 0.41
63 0.42
64 0.37
65 0.3
66 0.22
67 0.2
68 0.18
69 0.2
70 0.16
71 0.13
72 0.11
73 0.11
74 0.12
75 0.11
76 0.11
77 0.08
78 0.07
79 0.07
80 0.07
81 0.06
82 0.06
83 0.06
84 0.06
85 0.05
86 0.06
87 0.09
88 0.09
89 0.09
90 0.08
91 0.08
92 0.07
93 0.07
94 0.07
95 0.04
96 0.05
97 0.05
98 0.05
99 0.05
100 0.06
101 0.06
102 0.06
103 0.06
104 0.05
105 0.05
106 0.06
107 0.06
108 0.07
109 0.08
110 0.09
111 0.09
112 0.09
113 0.11
114 0.1
115 0.1
116 0.08
117 0.09
118 0.18
119 0.26
120 0.36
121 0.39
122 0.49
123 0.54
124 0.57
125 0.59
126 0.59
127 0.56
128 0.56
129 0.6
130 0.56
131 0.54
132 0.52
133 0.49
134 0.41
135 0.41
136 0.32
137 0.24
138 0.18
139 0.16
140 0.17
141 0.16
142 0.15
143 0.1
144 0.12
145 0.14
146 0.14
147 0.13
148 0.12
149 0.12
150 0.15
151 0.14
152 0.14
153 0.12
154 0.11
155 0.1
156 0.11
157 0.11
158 0.07
159 0.08
160 0.07
161 0.06
162 0.07
163 0.09
164 0.08
165 0.09
166 0.09
167 0.08
168 0.08
169 0.08
170 0.09
171 0.08
172 0.1
173 0.12
174 0.2
175 0.3
176 0.37
177 0.48
178 0.56
179 0.65
180 0.74
181 0.82
182 0.83
183 0.79
184 0.82
185 0.8
186 0.74
187 0.67
188 0.57
189 0.47
190 0.39
191 0.35
192 0.26
193 0.21
194 0.24
195 0.24
196 0.29
197 0.31
198 0.32
199 0.35
200 0.38
201 0.36
202 0.31