Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2M4Z2

Protein Details
Accession E2M4Z2    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
70-91AEDVRQPKKSRKSPQPTQLRSSHydrophilic
NLS Segment(s)
PositionSequence
27-35KGSKKSEKK
Subcellular Location(s) mito 16, nucl 8.5, cyto_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000915  60S_ribosomal_L6E  
IPR005568  Ribosomal_L6_N  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG mpr:MPER_15468  -  
Pfam View protein in Pfam  
PF03868  Ribosomal_L6e_N  
Amino Acid Sequences MARSKDIAPGVGRLSRSQVFAKRGLYKGSKKSEKKGVEPTPETVEKTVGGEKNGGKRLVPTSKAPRFYPAEDVRQPKKSRKSPQPTQLRSSITPGTVLILLAGRFRGKRVI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.26
3 0.28
4 0.3
5 0.33
6 0.34
7 0.37
8 0.41
9 0.42
10 0.42
11 0.45
12 0.47
13 0.48
14 0.53
15 0.59
16 0.63
17 0.61
18 0.66
19 0.7
20 0.67
21 0.66
22 0.67
23 0.64
24 0.62
25 0.6
26 0.56
27 0.52
28 0.48
29 0.43
30 0.34
31 0.27
32 0.19
33 0.18
34 0.19
35 0.15
36 0.14
37 0.16
38 0.17
39 0.22
40 0.26
41 0.24
42 0.2
43 0.21
44 0.25
45 0.27
46 0.27
47 0.27
48 0.33
49 0.39
50 0.42
51 0.41
52 0.41
53 0.4
54 0.4
55 0.43
56 0.37
57 0.39
58 0.41
59 0.48
60 0.47
61 0.52
62 0.54
63 0.54
64 0.6
65 0.63
66 0.67
67 0.72
68 0.77
69 0.78
70 0.84
71 0.87
72 0.82
73 0.78
74 0.75
75 0.69
76 0.6
77 0.56
78 0.48
79 0.37
80 0.32
81 0.27
82 0.22
83 0.17
84 0.16
85 0.11
86 0.1
87 0.1
88 0.1
89 0.12
90 0.13
91 0.14