Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A423WPR9

Protein Details
Accession A0A423WPR9    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
269-292NFVRLPKESKKDRAQKAQREGRSTHydrophilic
NLS Segment(s)
PositionSequence
316-372GKRDGGRGTKALLEKSRKRGPETVDGPRGGDREMGERYQKRLKVLESGRRDRGGKRR
Subcellular Location(s) cyto 9.5, cyto_nucl 8.5, nucl 6.5, E.R. 5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007146  Sas10/Utp3/C1D  
Pfam View protein in Pfam  
PF04000  Sas10_Utp3  
Amino Acid Sequences MAAATTLPVLLDSLTQSLSSTVEAALKIPSVEAPKEGLSLLDVKNELLLSYLQNLVFLILVKLRKAKQGDSDDENEDSSLDDEVVKKLVELRLYLEKGVRPLEDKLRYQIEKVLRATDDAERNEKARRAALEAQSDSESDSGSDEASDEDANENEVAPQADVTAYRPNLSKLARPAATDSAGKSSKDTNGVYRPPKIAPTSMPTTERREKRERGPMRSATMDEFVADELSSAPIAQPSIGTNIVNFGRRLKTATERKDEDERRNYEERNFVRLPKESKKDRAQKAQREGRSTRMDYGGEEWRDLGMGADRINRATGKRDGGRGTKALLEKSRKRGPETVDGPRGGDREMGERYQKRLKVLESGRRDRGGKRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.1
4 0.1
5 0.11
6 0.1
7 0.1
8 0.09
9 0.11
10 0.11
11 0.12
12 0.12
13 0.12
14 0.11
15 0.11
16 0.13
17 0.15
18 0.16
19 0.17
20 0.18
21 0.18
22 0.19
23 0.19
24 0.16
25 0.13
26 0.17
27 0.16
28 0.17
29 0.17
30 0.16
31 0.17
32 0.17
33 0.15
34 0.12
35 0.12
36 0.09
37 0.11
38 0.14
39 0.13
40 0.13
41 0.13
42 0.12
43 0.11
44 0.1
45 0.09
46 0.1
47 0.12
48 0.14
49 0.2
50 0.21
51 0.28
52 0.31
53 0.33
54 0.39
55 0.45
56 0.49
57 0.49
58 0.52
59 0.48
60 0.45
61 0.42
62 0.32
63 0.24
64 0.19
65 0.14
66 0.1
67 0.07
68 0.08
69 0.08
70 0.09
71 0.1
72 0.1
73 0.09
74 0.13
75 0.15
76 0.15
77 0.15
78 0.18
79 0.24
80 0.25
81 0.26
82 0.25
83 0.24
84 0.25
85 0.27
86 0.24
87 0.19
88 0.22
89 0.29
90 0.32
91 0.33
92 0.35
93 0.4
94 0.4
95 0.38
96 0.41
97 0.38
98 0.38
99 0.38
100 0.37
101 0.29
102 0.3
103 0.31
104 0.3
105 0.3
106 0.26
107 0.29
108 0.26
109 0.27
110 0.3
111 0.31
112 0.27
113 0.24
114 0.23
115 0.26
116 0.32
117 0.35
118 0.37
119 0.35
120 0.35
121 0.32
122 0.3
123 0.25
124 0.18
125 0.13
126 0.08
127 0.08
128 0.06
129 0.05
130 0.05
131 0.05
132 0.05
133 0.06
134 0.05
135 0.05
136 0.06
137 0.06
138 0.07
139 0.06
140 0.06
141 0.05
142 0.06
143 0.06
144 0.05
145 0.05
146 0.05
147 0.05
148 0.05
149 0.07
150 0.11
151 0.1
152 0.12
153 0.13
154 0.13
155 0.17
156 0.18
157 0.2
158 0.19
159 0.25
160 0.25
161 0.25
162 0.26
163 0.24
164 0.25
165 0.22
166 0.19
167 0.18
168 0.19
169 0.18
170 0.17
171 0.16
172 0.16
173 0.2
174 0.2
175 0.18
176 0.22
177 0.28
178 0.3
179 0.31
180 0.31
181 0.28
182 0.3
183 0.28
184 0.24
185 0.2
186 0.22
187 0.24
188 0.24
189 0.27
190 0.27
191 0.33
192 0.4
193 0.42
194 0.45
195 0.48
196 0.5
197 0.54
198 0.63
199 0.63
200 0.62
201 0.65
202 0.62
203 0.57
204 0.55
205 0.48
206 0.39
207 0.33
208 0.25
209 0.17
210 0.14
211 0.1
212 0.09
213 0.07
214 0.06
215 0.05
216 0.05
217 0.05
218 0.04
219 0.04
220 0.05
221 0.05
222 0.05
223 0.05
224 0.05
225 0.08
226 0.09
227 0.09
228 0.08
229 0.12
230 0.13
231 0.15
232 0.15
233 0.15
234 0.17
235 0.17
236 0.2
237 0.2
238 0.28
239 0.35
240 0.43
241 0.47
242 0.48
243 0.52
244 0.6
245 0.63
246 0.62
247 0.62
248 0.58
249 0.57
250 0.59
251 0.56
252 0.5
253 0.53
254 0.46
255 0.45
256 0.43
257 0.4
258 0.4
259 0.44
260 0.47
261 0.47
262 0.54
263 0.53
264 0.6
265 0.67
266 0.72
267 0.75
268 0.79
269 0.8
270 0.81
271 0.85
272 0.85
273 0.8
274 0.78
275 0.72
276 0.69
277 0.67
278 0.6
279 0.53
280 0.47
281 0.42
282 0.35
283 0.37
284 0.37
285 0.29
286 0.27
287 0.23
288 0.2
289 0.19
290 0.18
291 0.15
292 0.1
293 0.1
294 0.11
295 0.15
296 0.16
297 0.17
298 0.19
299 0.2
300 0.18
301 0.23
302 0.27
303 0.3
304 0.34
305 0.39
306 0.43
307 0.46
308 0.49
309 0.45
310 0.42
311 0.4
312 0.39
313 0.4
314 0.42
315 0.47
316 0.5
317 0.58
318 0.64
319 0.62
320 0.65
321 0.66
322 0.64
323 0.65
324 0.63
325 0.64
326 0.63
327 0.59
328 0.55
329 0.52
330 0.47
331 0.37
332 0.33
333 0.24
334 0.23
335 0.26
336 0.28
337 0.35
338 0.37
339 0.43
340 0.49
341 0.51
342 0.5
343 0.52
344 0.51
345 0.51
346 0.57
347 0.61
348 0.62
349 0.68
350 0.69
351 0.69
352 0.7