Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A423WLV7

Protein Details
Accession A0A423WLV7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
45-68WYIHWATLKPEQKKKKVKGEKGGKBasic
NLS Segment(s)
PositionSequence
55-68EQKKKKVKGEKGGK
Subcellular Location(s) plas 8, extr 6, mito 4, E.R. 4, cyto 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGQFDWFRRIGATPQAVSVLNDQPYLFTILVVVLVILILQGVFLWYIHWATLKPEQKKKKVKGEKGGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.26
4 0.25
5 0.25
6 0.21
7 0.17
8 0.17
9 0.16
10 0.15
11 0.15
12 0.17
13 0.13
14 0.09
15 0.08
16 0.07
17 0.07
18 0.07
19 0.06
20 0.02
21 0.02
22 0.02
23 0.02
24 0.02
25 0.01
26 0.01
27 0.01
28 0.02
29 0.02
30 0.02
31 0.03
32 0.04
33 0.04
34 0.05
35 0.06
36 0.06
37 0.1
38 0.19
39 0.27
40 0.35
41 0.45
42 0.55
43 0.64
44 0.75
45 0.8
46 0.82
47 0.86
48 0.87