Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A423WFZ9

Protein Details
Accession A0A423WFZ9    Localization Confidence High Confidence Score 17.7
NoLS Segment(s)
PositionSequenceProtein Nature
19-40DTGGAKKATRPKAKKEKVVDSWHydrophilic
133-160KAYDRAVREKERKKREEEKAAQKRREEEBasic
NLS Segment(s)
PositionSequence
24-34KKATRPKAKKE
139-158VREKERKKREEEKAAQKRRE
Subcellular Location(s) nucl 21, cyto_nucl 13, cyto 3
Family & Domain DBs
Amino Acid Sequences MSSKTPKDVTSAVSKLSLDTGGAKKATRPKAKKEKVVDSWEDEDLSSDTETEDTRPKPSEAESDDGTSAPPPTPASPSQGQRSFSPLDSPAGYLIASDPSSPAARPEKTDAVARRMIAAGLGLRAPKQTEEQKAYDRAVREKERKKREEEKAAQKRREEEAAAAKAAIWED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.26
3 0.25
4 0.21
5 0.13
6 0.17
7 0.18
8 0.19
9 0.21
10 0.2
11 0.24
12 0.33
13 0.43
14 0.48
15 0.52
16 0.59
17 0.7
18 0.78
19 0.82
20 0.81
21 0.81
22 0.78
23 0.79
24 0.72
25 0.66
26 0.6
27 0.52
28 0.44
29 0.34
30 0.27
31 0.2
32 0.17
33 0.12
34 0.09
35 0.08
36 0.08
37 0.09
38 0.09
39 0.14
40 0.14
41 0.17
42 0.19
43 0.19
44 0.2
45 0.21
46 0.26
47 0.23
48 0.26
49 0.24
50 0.23
51 0.23
52 0.22
53 0.2
54 0.15
55 0.12
56 0.09
57 0.08
58 0.08
59 0.08
60 0.12
61 0.13
62 0.17
63 0.2
64 0.24
65 0.3
66 0.32
67 0.33
68 0.3
69 0.33
70 0.3
71 0.26
72 0.24
73 0.18
74 0.16
75 0.15
76 0.15
77 0.11
78 0.09
79 0.09
80 0.07
81 0.06
82 0.06
83 0.06
84 0.06
85 0.06
86 0.07
87 0.08
88 0.08
89 0.11
90 0.15
91 0.15
92 0.18
93 0.22
94 0.24
95 0.25
96 0.31
97 0.3
98 0.3
99 0.31
100 0.29
101 0.26
102 0.23
103 0.21
104 0.15
105 0.13
106 0.09
107 0.07
108 0.08
109 0.07
110 0.07
111 0.08
112 0.09
113 0.1
114 0.15
115 0.21
116 0.28
117 0.33
118 0.36
119 0.41
120 0.44
121 0.45
122 0.43
123 0.39
124 0.38
125 0.41
126 0.47
127 0.52
128 0.58
129 0.66
130 0.73
131 0.76
132 0.79
133 0.81
134 0.82
135 0.83
136 0.83
137 0.84
138 0.85
139 0.89
140 0.86
141 0.81
142 0.76
143 0.69
144 0.65
145 0.55
146 0.5
147 0.49
148 0.46
149 0.42
150 0.37
151 0.32