Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8JP24

Protein Details
Accession G8JP24    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
65-94MYDGQAKPQKRSRRRRERRKSQKVPEEGSSBasic
NLS Segment(s)
PositionSequence
71-87KPQKRSRRRRERRKSQK
Subcellular Location(s) nucl 18, mito 7
Family & Domain DBs
KEGG erc:Ecym_2067  -  
Amino Acid Sequences MTLSTVLPSETASNTQTMDLNLLKSWNPQLQKNKSKVREAQKQLLKGVRKPATEPELTKGSLGWMYDGQAKPQKRSRRRRERRKSQKVPEEGSSGSTGAGRISPSKEKTSDDRKADDRKANVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.16
4 0.14
5 0.16
6 0.15
7 0.15
8 0.14
9 0.15
10 0.15
11 0.16
12 0.2
13 0.22
14 0.24
15 0.3
16 0.4
17 0.49
18 0.57
19 0.63
20 0.69
21 0.69
22 0.73
23 0.74
24 0.73
25 0.73
26 0.71
27 0.72
28 0.68
29 0.65
30 0.62
31 0.59
32 0.53
33 0.46
34 0.49
35 0.44
36 0.4
37 0.38
38 0.39
39 0.38
40 0.37
41 0.35
42 0.29
43 0.27
44 0.26
45 0.24
46 0.19
47 0.15
48 0.13
49 0.12
50 0.09
51 0.06
52 0.07
53 0.13
54 0.13
55 0.15
56 0.21
57 0.22
58 0.26
59 0.33
60 0.43
61 0.47
62 0.59
63 0.67
64 0.73
65 0.83
66 0.9
67 0.94
68 0.95
69 0.96
70 0.97
71 0.96
72 0.95
73 0.93
74 0.89
75 0.83
76 0.74
77 0.67
78 0.56
79 0.47
80 0.38
81 0.28
82 0.21
83 0.16
84 0.13
85 0.09
86 0.1
87 0.09
88 0.11
89 0.15
90 0.22
91 0.26
92 0.31
93 0.33
94 0.37
95 0.44
96 0.51
97 0.56
98 0.54
99 0.56
100 0.59
101 0.66
102 0.7
103 0.69