Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A423VEG6

Protein Details
Accession A0A423VEG6    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
57-77FQAYRDCKKNWINKRKAEGGGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MPAPADKTDDPWDEKTREKFNSKSRSEWLDPCQEAASRSIKCLNRNGGDRKMCQEYFQAYRDCKKNWINKRKAEGGGLFT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.48
3 0.5
4 0.52
5 0.53
6 0.54
7 0.58
8 0.65
9 0.62
10 0.6
11 0.57
12 0.58
13 0.56
14 0.54
15 0.48
16 0.46
17 0.43
18 0.39
19 0.35
20 0.29
21 0.25
22 0.23
23 0.24
24 0.16
25 0.17
26 0.23
27 0.24
28 0.26
29 0.31
30 0.33
31 0.33
32 0.39
33 0.43
34 0.45
35 0.46
36 0.45
37 0.44
38 0.45
39 0.41
40 0.36
41 0.33
42 0.3
43 0.31
44 0.33
45 0.34
46 0.3
47 0.38
48 0.42
49 0.41
50 0.44
51 0.48
52 0.54
53 0.6
54 0.68
55 0.71
56 0.74
57 0.8
58 0.8
59 0.75
60 0.71