Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A423W6M1

Protein Details
Accession A0A423W6M1    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
50-72ASPSPRKPSSKQATPKKRPLEGGHydrophilic
NLS Segment(s)
PositionSequence
51-73SPSPRKPSSKQATPKKRPLEGGR
Subcellular Location(s) mito 13, nucl 11.5, cyto_nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013734  TF_Nrm1/Whi5  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF08528  Whi5  
Amino Acid Sequences MNVMATPTKRRVLGPIDVNIQMSPRSSKVSGSPLKKATSREGTATVSRHASPSPRKPSSKQATPKKRPLEGGRGGVQPASKKLCSDFTAATTTEVSAPANVEPVQKHAAVQDVDEDEPSASQPTAGRRSISPDTSSVFDTSGMNTSQDTTITEPDTDAPITITATATAPASTPSSVIETPSSLSPPPPPPRRVPTREEFRQKAEILRLRLSLATYKVKTGQTDVPLDKLQVRPVPGMARHRTPLPSMSAHTIQRSTPAQQWYRSLTPPGSRDVVVVAAAAEEDDKAAGKPSPPEKSVLPLPSVLSTPRKRSNDEEEEEARLTSSALRGGAAKGLLSLSQGSPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.46
3 0.46
4 0.45
5 0.45
6 0.38
7 0.33
8 0.26
9 0.22
10 0.2
11 0.18
12 0.22
13 0.22
14 0.24
15 0.27
16 0.36
17 0.42
18 0.44
19 0.5
20 0.5
21 0.54
22 0.56
23 0.55
24 0.53
25 0.54
26 0.51
27 0.46
28 0.45
29 0.45
30 0.45
31 0.43
32 0.38
33 0.32
34 0.3
35 0.28
36 0.27
37 0.31
38 0.36
39 0.44
40 0.51
41 0.56
42 0.61
43 0.63
44 0.72
45 0.74
46 0.74
47 0.74
48 0.75
49 0.79
50 0.83
51 0.89
52 0.86
53 0.81
54 0.79
55 0.76
56 0.75
57 0.7
58 0.65
59 0.6
60 0.54
61 0.49
62 0.42
63 0.37
64 0.29
65 0.28
66 0.27
67 0.23
68 0.23
69 0.24
70 0.28
71 0.28
72 0.3
73 0.26
74 0.23
75 0.26
76 0.25
77 0.24
78 0.2
79 0.18
80 0.15
81 0.14
82 0.11
83 0.09
84 0.09
85 0.08
86 0.1
87 0.1
88 0.12
89 0.12
90 0.15
91 0.17
92 0.16
93 0.16
94 0.15
95 0.19
96 0.16
97 0.16
98 0.16
99 0.15
100 0.15
101 0.15
102 0.14
103 0.1
104 0.1
105 0.1
106 0.08
107 0.06
108 0.07
109 0.09
110 0.13
111 0.19
112 0.2
113 0.21
114 0.2
115 0.27
116 0.3
117 0.3
118 0.26
119 0.22
120 0.23
121 0.23
122 0.24
123 0.18
124 0.14
125 0.13
126 0.12
127 0.11
128 0.11
129 0.1
130 0.09
131 0.09
132 0.09
133 0.09
134 0.09
135 0.09
136 0.08
137 0.1
138 0.1
139 0.1
140 0.09
141 0.1
142 0.11
143 0.1
144 0.08
145 0.07
146 0.06
147 0.06
148 0.06
149 0.05
150 0.05
151 0.05
152 0.05
153 0.05
154 0.05
155 0.05
156 0.06
157 0.06
158 0.06
159 0.06
160 0.06
161 0.08
162 0.08
163 0.09
164 0.09
165 0.08
166 0.09
167 0.09
168 0.1
169 0.08
170 0.09
171 0.12
172 0.19
173 0.27
174 0.33
175 0.37
176 0.41
177 0.48
178 0.57
179 0.58
180 0.57
181 0.57
182 0.59
183 0.64
184 0.67
185 0.63
186 0.58
187 0.57
188 0.52
189 0.46
190 0.45
191 0.41
192 0.36
193 0.35
194 0.32
195 0.27
196 0.27
197 0.25
198 0.2
199 0.19
200 0.22
201 0.2
202 0.21
203 0.25
204 0.26
205 0.25
206 0.27
207 0.27
208 0.25
209 0.3
210 0.29
211 0.28
212 0.27
213 0.27
214 0.27
215 0.23
216 0.24
217 0.21
218 0.22
219 0.2
220 0.21
221 0.24
222 0.25
223 0.32
224 0.32
225 0.33
226 0.33
227 0.35
228 0.35
229 0.33
230 0.32
231 0.27
232 0.26
233 0.24
234 0.27
235 0.29
236 0.29
237 0.29
238 0.28
239 0.24
240 0.27
241 0.27
242 0.25
243 0.27
244 0.33
245 0.34
246 0.36
247 0.39
248 0.41
249 0.42
250 0.41
251 0.39
252 0.35
253 0.37
254 0.36
255 0.36
256 0.33
257 0.29
258 0.27
259 0.24
260 0.21
261 0.15
262 0.13
263 0.09
264 0.06
265 0.06
266 0.05
267 0.05
268 0.04
269 0.04
270 0.04
271 0.05
272 0.05
273 0.07
274 0.09
275 0.11
276 0.18
277 0.25
278 0.31
279 0.32
280 0.35
281 0.34
282 0.39
283 0.44
284 0.4
285 0.34
286 0.3
287 0.3
288 0.29
289 0.29
290 0.27
291 0.3
292 0.33
293 0.39
294 0.47
295 0.5
296 0.53
297 0.59
298 0.65
299 0.65
300 0.63
301 0.62
302 0.55
303 0.55
304 0.51
305 0.44
306 0.35
307 0.25
308 0.21
309 0.16
310 0.14
311 0.13
312 0.12
313 0.13
314 0.13
315 0.14
316 0.17
317 0.15
318 0.14
319 0.12
320 0.12
321 0.12
322 0.12
323 0.13