Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8JV53

Protein Details
Accession G8JV53    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
25-49DTWKMKKPLRSCVRCRKNKVKCDSAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
KEGG erc:Ecym_6141  -  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MAAGMSDNEIQHKRPGGHSEGYIHDTWKMKKPLRSCVRCRKNKVKCDSAIRRPKPCSSCLKKGVSCELEYVIPPQRSKELRNLYENVAYMRLKLDELTESCDRLLGYCRAGVDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.36
3 0.36
4 0.37
5 0.37
6 0.36
7 0.35
8 0.36
9 0.32
10 0.27
11 0.26
12 0.28
13 0.29
14 0.34
15 0.39
16 0.41
17 0.46
18 0.5
19 0.57
20 0.63
21 0.68
22 0.69
23 0.72
24 0.78
25 0.81
26 0.86
27 0.86
28 0.85
29 0.85
30 0.83
31 0.8
32 0.75
33 0.76
34 0.75
35 0.75
36 0.76
37 0.72
38 0.71
39 0.67
40 0.68
41 0.6
42 0.56
43 0.56
44 0.53
45 0.56
46 0.56
47 0.58
48 0.53
49 0.53
50 0.55
51 0.47
52 0.4
53 0.32
54 0.27
55 0.21
56 0.2
57 0.2
58 0.19
59 0.19
60 0.18
61 0.19
62 0.24
63 0.27
64 0.29
65 0.36
66 0.39
67 0.42
68 0.47
69 0.48
70 0.44
71 0.45
72 0.43
73 0.34
74 0.29
75 0.24
76 0.19
77 0.18
78 0.16
79 0.13
80 0.13
81 0.13
82 0.14
83 0.15
84 0.21
85 0.21
86 0.22
87 0.21
88 0.22
89 0.2
90 0.17
91 0.21
92 0.18
93 0.18
94 0.19