Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8JTH9

Protein Details
Accession G8JTH9    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
38-61GNDLYSRLRRRRRGSSERCRGDKTBasic
NLS Segment(s)
PositionSequence
46-51RRRRRG
Subcellular Location(s) mito 10, nucl 6.5, cyto_nucl 6, cyto 4.5, plas 3
Family & Domain DBs
KEGG erc:Ecym_4268  -  
Amino Acid Sequences MRPLVARDEGELSAMSWDRLFADNKSELVLLRCAAAFGNDLYSRLRRRRRGSSERCRGDKTRSTWLQKRMRKQEATDRRQVQMQVWEMLQRVSCDGAGLSAGYCHGVCYVCFFVYFASGQTAHAQQLRYCCVFFHFLFHIMMTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.13
3 0.1
4 0.1
5 0.11
6 0.14
7 0.16
8 0.13
9 0.19
10 0.2
11 0.2
12 0.21
13 0.2
14 0.18
15 0.18
16 0.19
17 0.13
18 0.12
19 0.12
20 0.1
21 0.1
22 0.1
23 0.08
24 0.07
25 0.11
26 0.1
27 0.11
28 0.13
29 0.18
30 0.24
31 0.32
32 0.41
33 0.45
34 0.52
35 0.62
36 0.7
37 0.76
38 0.81
39 0.83
40 0.85
41 0.84
42 0.81
43 0.76
44 0.68
45 0.65
46 0.61
47 0.54
48 0.54
49 0.53
50 0.56
51 0.58
52 0.64
53 0.67
54 0.65
55 0.7
56 0.7
57 0.7
58 0.65
59 0.62
60 0.63
61 0.64
62 0.64
63 0.63
64 0.56
65 0.5
66 0.5
67 0.47
68 0.38
69 0.33
70 0.29
71 0.22
72 0.19
73 0.2
74 0.18
75 0.18
76 0.16
77 0.11
78 0.09
79 0.09
80 0.08
81 0.07
82 0.07
83 0.06
84 0.06
85 0.05
86 0.04
87 0.04
88 0.04
89 0.05
90 0.05
91 0.05
92 0.06
93 0.06
94 0.06
95 0.11
96 0.13
97 0.12
98 0.12
99 0.12
100 0.11
101 0.13
102 0.13
103 0.09
104 0.11
105 0.11
106 0.12
107 0.15
108 0.16
109 0.17
110 0.2
111 0.2
112 0.19
113 0.24
114 0.29
115 0.28
116 0.26
117 0.24
118 0.25
119 0.29
120 0.27
121 0.27
122 0.25
123 0.25
124 0.26