Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A423WQE9

Protein Details
Accession A0A423WQE9   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
208-231LAKSKYTKANEKRQKRNERVQAPSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 9, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR045107  SAC3/GANP/THP3  
IPR005062  SAC3/GANP/THP3_conserved  
Pfam View protein in Pfam  
PF03399  SAC3_GANP  
Amino Acid Sequences MSNMMGWAAVSGQAAAAPPPPGTYAYPNPAYTQVQVRQNFSQPYSVPPPVYPGAPVTPSPYGAPQMPQPPPANQPEPAKKKIEWPLSVRQYVQRSFTPANLDPSVPRSDMETKLKEVISRASDGGQLLTIDWDNMPLPQQLIREERARQLEAQKSGPGSSPSSSKKRKSFDVDHDNSIPTAAPWHRNALEYRVSYAANDKRHLMDEPLAKSKYTKANEKRQKRNERVQAPSPSPEPPAGPVVGTSQKLEKSYLRLTAPPKPEVVRPESILRQTLDLLKKKWRKERNYSYICDQFKSMRQDLTVQRIKNDLTVEVYEIHARIALEMGDLGEYNQCQTQLMALYKLGLKGHPDEFKAYRILYFIHTANRSALNDALADLTTAEKSEPAIKHALDIRSALALGNYHRFFQLYIDPSNIKMGAYLMDMFVGRERLAALCNICRAYKMDVKLRFITEELGFDGDSDAYQFLIDQDAQELLEERNSEYYFLTAKAKSHFEGAKAKAFGRVDIKGQI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.1
4 0.1
5 0.1
6 0.11
7 0.13
8 0.15
9 0.17
10 0.24
11 0.28
12 0.34
13 0.38
14 0.38
15 0.38
16 0.41
17 0.4
18 0.36
19 0.38
20 0.38
21 0.42
22 0.45
23 0.48
24 0.48
25 0.52
26 0.54
27 0.47
28 0.46
29 0.38
30 0.42
31 0.44
32 0.44
33 0.39
34 0.34
35 0.38
36 0.34
37 0.34
38 0.27
39 0.23
40 0.23
41 0.24
42 0.24
43 0.23
44 0.23
45 0.24
46 0.24
47 0.23
48 0.22
49 0.21
50 0.23
51 0.24
52 0.3
53 0.32
54 0.37
55 0.37
56 0.38
57 0.42
58 0.48
59 0.46
60 0.43
61 0.5
62 0.54
63 0.59
64 0.61
65 0.6
66 0.53
67 0.58
68 0.62
69 0.62
70 0.58
71 0.56
72 0.61
73 0.64
74 0.66
75 0.59
76 0.56
77 0.54
78 0.51
79 0.49
80 0.41
81 0.4
82 0.39
83 0.39
84 0.4
85 0.36
86 0.39
87 0.36
88 0.34
89 0.29
90 0.31
91 0.32
92 0.25
93 0.22
94 0.21
95 0.25
96 0.3
97 0.36
98 0.36
99 0.35
100 0.38
101 0.39
102 0.35
103 0.32
104 0.31
105 0.26
106 0.26
107 0.24
108 0.21
109 0.22
110 0.2
111 0.19
112 0.14
113 0.11
114 0.09
115 0.1
116 0.09
117 0.07
118 0.07
119 0.08
120 0.07
121 0.08
122 0.09
123 0.09
124 0.09
125 0.11
126 0.13
127 0.16
128 0.19
129 0.22
130 0.25
131 0.26
132 0.31
133 0.33
134 0.34
135 0.33
136 0.36
137 0.4
138 0.39
139 0.38
140 0.35
141 0.31
142 0.3
143 0.29
144 0.24
145 0.2
146 0.18
147 0.23
148 0.27
149 0.36
150 0.43
151 0.48
152 0.54
153 0.56
154 0.62
155 0.64
156 0.66
157 0.67
158 0.7
159 0.66
160 0.63
161 0.6
162 0.53
163 0.44
164 0.36
165 0.26
166 0.15
167 0.16
168 0.14
169 0.16
170 0.17
171 0.21
172 0.22
173 0.24
174 0.25
175 0.25
176 0.29
177 0.25
178 0.26
179 0.23
180 0.22
181 0.2
182 0.26
183 0.27
184 0.24
185 0.25
186 0.25
187 0.24
188 0.26
189 0.26
190 0.21
191 0.21
192 0.23
193 0.25
194 0.3
195 0.29
196 0.28
197 0.28
198 0.3
199 0.34
200 0.32
201 0.39
202 0.41
203 0.52
204 0.62
205 0.71
206 0.77
207 0.79
208 0.86
209 0.84
210 0.86
211 0.84
212 0.82
213 0.78
214 0.75
215 0.7
216 0.62
217 0.56
218 0.48
219 0.4
220 0.33
221 0.28
222 0.21
223 0.16
224 0.15
225 0.13
226 0.11
227 0.1
228 0.11
229 0.13
230 0.14
231 0.13
232 0.13
233 0.14
234 0.15
235 0.17
236 0.15
237 0.17
238 0.19
239 0.22
240 0.21
241 0.24
242 0.26
243 0.32
244 0.34
245 0.31
246 0.3
247 0.28
248 0.29
249 0.29
250 0.3
251 0.25
252 0.23
253 0.26
254 0.27
255 0.26
256 0.26
257 0.22
258 0.18
259 0.17
260 0.21
261 0.24
262 0.26
263 0.27
264 0.34
265 0.4
266 0.46
267 0.55
268 0.58
269 0.61
270 0.68
271 0.77
272 0.78
273 0.78
274 0.74
275 0.71
276 0.69
277 0.62
278 0.51
279 0.42
280 0.34
281 0.33
282 0.37
283 0.33
284 0.26
285 0.25
286 0.31
287 0.33
288 0.39
289 0.39
290 0.32
291 0.32
292 0.33
293 0.32
294 0.29
295 0.26
296 0.18
297 0.14
298 0.14
299 0.14
300 0.13
301 0.13
302 0.11
303 0.11
304 0.1
305 0.09
306 0.08
307 0.07
308 0.07
309 0.06
310 0.05
311 0.05
312 0.05
313 0.04
314 0.04
315 0.04
316 0.05
317 0.05
318 0.06
319 0.07
320 0.07
321 0.07
322 0.07
323 0.08
324 0.1
325 0.12
326 0.12
327 0.11
328 0.12
329 0.13
330 0.15
331 0.14
332 0.11
333 0.12
334 0.15
335 0.2
336 0.22
337 0.22
338 0.25
339 0.26
340 0.28
341 0.28
342 0.25
343 0.21
344 0.18
345 0.18
346 0.16
347 0.17
348 0.17
349 0.2
350 0.21
351 0.21
352 0.23
353 0.25
354 0.23
355 0.21
356 0.2
357 0.15
358 0.14
359 0.13
360 0.12
361 0.09
362 0.08
363 0.07
364 0.07
365 0.06
366 0.06
367 0.06
368 0.06
369 0.07
370 0.14
371 0.14
372 0.16
373 0.2
374 0.2
375 0.23
376 0.29
377 0.29
378 0.23
379 0.23
380 0.21
381 0.18
382 0.18
383 0.15
384 0.1
385 0.1
386 0.11
387 0.18
388 0.18
389 0.18
390 0.18
391 0.19
392 0.18
393 0.2
394 0.25
395 0.21
396 0.22
397 0.25
398 0.25
399 0.26
400 0.28
401 0.26
402 0.18
403 0.14
404 0.13
405 0.11
406 0.11
407 0.11
408 0.08
409 0.09
410 0.09
411 0.09
412 0.1
413 0.11
414 0.09
415 0.09
416 0.1
417 0.1
418 0.11
419 0.13
420 0.15
421 0.16
422 0.19
423 0.21
424 0.2
425 0.21
426 0.23
427 0.26
428 0.3
429 0.33
430 0.39
431 0.43
432 0.48
433 0.51
434 0.5
435 0.46
436 0.4
437 0.38
438 0.3
439 0.26
440 0.22
441 0.19
442 0.16
443 0.15
444 0.15
445 0.11
446 0.1
447 0.09
448 0.08
449 0.07
450 0.07
451 0.06
452 0.06
453 0.09
454 0.09
455 0.08
456 0.1
457 0.1
458 0.1
459 0.11
460 0.12
461 0.1
462 0.12
463 0.13
464 0.13
465 0.18
466 0.18
467 0.19
468 0.17
469 0.19
470 0.18
471 0.19
472 0.23
473 0.2
474 0.23
475 0.27
476 0.31
477 0.3
478 0.35
479 0.36
480 0.36
481 0.43
482 0.44
483 0.47
484 0.46
485 0.45
486 0.45
487 0.43
488 0.43
489 0.39
490 0.38