Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A423WNB4

Protein Details
Accession A0A423WNB4    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
70-92LKESRVRMSPKPQNKRSKKRKQNBasic
NLS Segment(s)
PositionSequence
74-92RVRMSPKPQNKRSKKRKQN
Subcellular Location(s) nucl 23.5, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MTEGIKKEADIEVEDKDAEQSQAVKTVWVRNTVSVCASARQAKNKPKMIKDEGRLLNSAMLIMTANKSILKESRVRMSPKPQNKRSKKRKQN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.16
3 0.15
4 0.14
5 0.12
6 0.11
7 0.11
8 0.1
9 0.15
10 0.15
11 0.16
12 0.17
13 0.23
14 0.24
15 0.27
16 0.28
17 0.26
18 0.27
19 0.27
20 0.25
21 0.21
22 0.19
23 0.16
24 0.17
25 0.21
26 0.21
27 0.27
28 0.34
29 0.4
30 0.48
31 0.54
32 0.57
33 0.55
34 0.6
35 0.6
36 0.6
37 0.54
38 0.56
39 0.51
40 0.48
41 0.44
42 0.37
43 0.31
44 0.24
45 0.2
46 0.11
47 0.07
48 0.06
49 0.05
50 0.06
51 0.05
52 0.06
53 0.07
54 0.07
55 0.1
56 0.12
57 0.15
58 0.2
59 0.24
60 0.31
61 0.37
62 0.42
63 0.46
64 0.54
65 0.61
66 0.66
67 0.73
68 0.75
69 0.8
70 0.86
71 0.91
72 0.92