Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A423VY22

Protein Details
Accession A0A423VY22    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
7-26TVKLAHHKLRKSKTKGSIVIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, cyto_mito 13.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MGAVLTTVKLAHHKLRKSKTKGSIVITGGFAGYWADPLVQASSESYVVSRKKTTSPSMGSLLAPPLPHDAIQTSHCMDETRSPIKPGKDVALALVYSATAQQPRRVETYGDEPESTLKSSSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.6
3 0.69
4 0.73
5 0.79
6 0.79
7 0.8
8 0.79
9 0.74
10 0.7
11 0.62
12 0.55
13 0.46
14 0.36
15 0.27
16 0.2
17 0.15
18 0.09
19 0.07
20 0.05
21 0.05
22 0.04
23 0.05
24 0.06
25 0.06
26 0.06
27 0.06
28 0.06
29 0.07
30 0.07
31 0.07
32 0.07
33 0.12
34 0.13
35 0.15
36 0.16
37 0.17
38 0.2
39 0.25
40 0.28
41 0.3
42 0.31
43 0.32
44 0.33
45 0.32
46 0.28
47 0.24
48 0.21
49 0.16
50 0.13
51 0.1
52 0.09
53 0.09
54 0.09
55 0.09
56 0.09
57 0.1
58 0.11
59 0.13
60 0.12
61 0.12
62 0.12
63 0.12
64 0.12
65 0.15
66 0.19
67 0.21
68 0.21
69 0.24
70 0.28
71 0.3
72 0.31
73 0.28
74 0.26
75 0.25
76 0.24
77 0.23
78 0.21
79 0.19
80 0.16
81 0.14
82 0.1
83 0.08
84 0.08
85 0.08
86 0.11
87 0.13
88 0.19
89 0.22
90 0.25
91 0.29
92 0.3
93 0.3
94 0.29
95 0.37
96 0.38
97 0.38
98 0.35
99 0.32
100 0.33
101 0.33
102 0.31