Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LAV3

Protein Details
Accession E2LAV3   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
101-121SSHQSPRKLRHPSKLRSRDLTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 12, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
KEGG mpr:MPER_03231  -  
Amino Acid Sequences MVQLPKPLARVGDHVRVCGKVAQYFESRQIIATNIEKCVSNDQPLHWKEVLKLHSTYYSLSEPFTIPAPILHPPEPNQRAVQENSSLVTSAAPSPTKSTASSHQSPRKLRHPSKLRSRDLTGLTFRIYVKHFMDRYHSMFNPGPDTTNE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.38
3 0.36
4 0.36
5 0.32
6 0.29
7 0.23
8 0.24
9 0.25
10 0.27
11 0.29
12 0.32
13 0.31
14 0.28
15 0.25
16 0.24
17 0.22
18 0.21
19 0.24
20 0.2
21 0.19
22 0.19
23 0.19
24 0.2
25 0.24
26 0.23
27 0.23
28 0.23
29 0.24
30 0.32
31 0.33
32 0.37
33 0.32
34 0.3
35 0.28
36 0.33
37 0.34
38 0.28
39 0.28
40 0.24
41 0.25
42 0.24
43 0.23
44 0.19
45 0.18
46 0.15
47 0.14
48 0.14
49 0.12
50 0.12
51 0.12
52 0.09
53 0.07
54 0.07
55 0.09
56 0.11
57 0.13
58 0.14
59 0.14
60 0.16
61 0.25
62 0.27
63 0.27
64 0.25
65 0.23
66 0.26
67 0.26
68 0.26
69 0.18
70 0.17
71 0.16
72 0.15
73 0.14
74 0.1
75 0.09
76 0.08
77 0.07
78 0.08
79 0.09
80 0.09
81 0.11
82 0.13
83 0.15
84 0.15
85 0.17
86 0.22
87 0.29
88 0.34
89 0.41
90 0.47
91 0.53
92 0.58
93 0.61
94 0.64
95 0.68
96 0.68
97 0.69
98 0.72
99 0.74
100 0.79
101 0.83
102 0.8
103 0.76
104 0.74
105 0.7
106 0.63
107 0.59
108 0.51
109 0.43
110 0.38
111 0.34
112 0.3
113 0.27
114 0.25
115 0.25
116 0.25
117 0.31
118 0.31
119 0.31
120 0.38
121 0.4
122 0.43
123 0.45
124 0.42
125 0.4
126 0.42
127 0.43
128 0.41
129 0.36