Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A423VY27

Protein Details
Accession A0A423VY27   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
63-91VKKGEAKVKKSTKKTETKAKAPKTKKAAAHydrophilic
NLS Segment(s)
PositionSequence
27-93IKRKPATKKAGSKPTGVTKKVAPKKENTVVKKVKAAVKKGEAKVKKSTKKTETKAKAPKTKKAAAAK
Subcellular Location(s) nucl 13, cyto_nucl 10, mito 9, cyto 5
Family & Domain DBs
Amino Acid Sequences MAREGTRSSTGHAAPRQFQTVDTAPAIKRKPATKKAGSKPTGVTKKVAPKKENTVVKKVKAAVKKGEAKVKKSTKKTETKAKAPKTKKAAAAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.4
3 0.41
4 0.35
5 0.33
6 0.32
7 0.3
8 0.28
9 0.25
10 0.25
11 0.22
12 0.28
13 0.29
14 0.26
15 0.28
16 0.32
17 0.4
18 0.46
19 0.54
20 0.57
21 0.66
22 0.72
23 0.78
24 0.73
25 0.65
26 0.6
27 0.61
28 0.59
29 0.5
30 0.43
31 0.37
32 0.44
33 0.49
34 0.51
35 0.44
36 0.41
37 0.48
38 0.54
39 0.58
40 0.52
41 0.56
42 0.54
43 0.54
44 0.54
45 0.51
46 0.49
47 0.46
48 0.47
49 0.44
50 0.47
51 0.53
52 0.53
53 0.59
54 0.57
55 0.56
56 0.61
57 0.65
58 0.66
59 0.66
60 0.71
61 0.72
62 0.77
63 0.8
64 0.82
65 0.8
66 0.82
67 0.84
68 0.84
69 0.85
70 0.81
71 0.83
72 0.8
73 0.79