Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A423VN10

Protein Details
Accession A0A423VN10    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
60-81IRNGKDKRSRKLAKKRLGTFGRBasic
NLS Segment(s)
PositionSequence
61-84RNGKDKRSRKLAKKRLGTFGRAKA
Subcellular Location(s) mito 21, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
PROSITE View protein in PROSITE  
PS01190  RIBOSOMAL_L36E  
Amino Acid Sequences MAAAQGTPRSGLVVKTTPRVNTKRVSRMKGHLSKRTNFVRSLIKEVAGLAPYEKRIVELIRNGKDKRSRKLAKKRLGTFGRAKAKVEEMQQMIAESRRTGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.29
3 0.32
4 0.34
5 0.42
6 0.45
7 0.45
8 0.46
9 0.52
10 0.58
11 0.62
12 0.64
13 0.61
14 0.64
15 0.69
16 0.7
17 0.69
18 0.68
19 0.66
20 0.63
21 0.65
22 0.65
23 0.57
24 0.49
25 0.45
26 0.45
27 0.4
28 0.43
29 0.36
30 0.29
31 0.27
32 0.26
33 0.23
34 0.15
35 0.13
36 0.07
37 0.07
38 0.08
39 0.08
40 0.07
41 0.07
42 0.08
43 0.09
44 0.11
45 0.17
46 0.24
47 0.29
48 0.35
49 0.35
50 0.4
51 0.48
52 0.51
53 0.52
54 0.55
55 0.59
56 0.64
57 0.75
58 0.79
59 0.8
60 0.84
61 0.82
62 0.82
63 0.77
64 0.73
65 0.69
66 0.69
67 0.69
68 0.61
69 0.57
70 0.5
71 0.5
72 0.47
73 0.43
74 0.41
75 0.33
76 0.33
77 0.31
78 0.29
79 0.26
80 0.25
81 0.23